SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_02374-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_02374-P1
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000000000000269
Family 7-Fe ferredoxin 0.00008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_02374-P1
Sequence length 81
Comment pep:novel supercontig:GCA_000347455.1:scaffold1128:103747:103989:1 gene:TRIUR3_02374 transcript:TRIUR3_02374-T1 description:""
Sequence
FTHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPT
DFLSVHIYLGPETTCSMALSY
Download sequence
Identical sequences T1LCU3
TRIUR3_02374-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]