SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_04400-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_04400-P1
Domain Number 1 Region: 5-63
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000207
Family 7-Fe ferredoxin 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_04400-P1
Sequence length 80
Comment pep:novel supercontig:GCA_000347455.1:scaffold52136:12030:12271:1 gene:TRIUR3_04400 transcript:TRIUR3_04400-T1 description:""
Sequence
MSHSVKNYDTCRGCTQCVRTCPTDVLEMIPWDGCKAKQIASAPRTENCVGCKRCESACPT
DFSVRVYLGPETTCSMALSY
Download sequence
Identical sequences T1LI73
TRIUR3_04400-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]