SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_05707-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  TRIUR3_05707-P1
Domain Number - Region: 5-37
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000457
Family 7-Fe ferredoxin 0.013
Further Details:      
 
Domain Number - Region: 168-237
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0223
Family Universal stress protein-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_05707-P1
Sequence length 409
Comment pep:novel supercontig:GCA_000347455.1:scaffold23926:17138:21285:-1 gene:TRIUR3_05707 transcript:TRIUR3_05707-T1 description:"Uncharacterized protein "
Sequence
MSHFVKINDTCIGYTQCVRACPTASAKVGGGGAICVVPFLKASPWRSSRPLSATSEGNPR
SDDRMTAALWCHSSLGGVILGGTHMIEGPEDGFFGGACRFGVRCGRIDSGRRTTLSGVVV
ASMAERPNTMAAAASYPAGVLVEECAGLIGAPYPTGVLIRTSVGVKFHADKLSPEPVRAF
RRAERERAHEMLDDYIHQCSQIKVKCEKLVIEQEDAASGLVELIRLRRITKLVIAAAEDK
HYSKKLDKPVSKTATEIMERADPSCKIWFVCKEQLVCTRTKEVQIAPLTVAAPLLPSPGH
EAQHLQSPQEEGDTEMEPSFDDELEEARKAVGELMRRALKESCRRQKAEEEMATSLQKAQ
EHEQLYLEEVKKREELEAALARADREIARLRQAIQQKHDRGGSHGEIDS
Download sequence
Identical sequences M7YRK0
TRIUR3_05707-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]