SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_21795-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_21795-P1
Domain Number 1 Region: 1392-1681
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-81
Family Protein kinases, catalytic subunit 0.0000972
Further Details:      
 
Domain Number 2 Region: 474-756
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-74
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 3 Region: 962-1075
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.51e-25
Family alpha-D-mannose-specific plant lectins 0.0031
Further Details:      
 
Domain Number 4 Region: 40-154
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-24
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_21795-P1
Sequence length 1726
Comment pep:novel supercontig:GCA_000347455.1:scaffold58299:47240:88911:-1 gene:TRIUR3_21795 transcript:TRIUR3_21795-T1 description:""
Sequence
GNTIISDGGAFALGFFNPSNSTPAKLYLGIWYNNIPELTVVWVANRETPISNNTSSAPML
SLTNTSNLIISEDNSGDRVLWTTANITTTIGSSPPTAVLLNTGNFVIRSANGTTLWQSFD
HPTDTLLPGMKMRIKYSSRDTRDHLVSWKGPGDPSPGRFSLGGDLDTPLQIFLRDGQSLV
TRSNPWTGIQVFSFSQQQLVGAMNVSDVLIYMAIIGNGDDIYVTYSLSDGAPPTRTVLTY
SGQYHIAIWSSRLSVWVVVSMWSAECNRYGHCGPYGYCDETVVPIPTCKCLDGFEPANKE
EWTSGKFLAGCRRKELLHGCTSNYLAMLGMKSPDKFALVGGGRSTSEECLAECNRNCSCV
GYVHRNVSSGSFGGAATMCLLWAGDLIDTGKLREPGGETLYLRLAGKRRKSNAVRIMLPV
LISSFFAVICISLAWLKCKGKNKNCRRHKNIRLDGMSTSEELGRDEAPHDQDFPFVRLEE
IFLVTHNFSEACKIGQGGFGKVYKGLLGGQEVAIKRLSRDSQQGTKEFRNEVILIAKLQH
RNLVRLLGCCDEGGEKLLIYEYLPNKSLDATLFDDSRKLLLDWEKRFSIIKGVARGLLYL
HEDSRFTIIHRDLKAGNVLLDAYMKPKIADFGMARIIGDNQQNENTQRVVGTYGYMAPEY
AMQGFFSTKSDVYSFGVLILEISWNMWKEGTINELADSSIMDTCSLDEASLCIHVALLCV
QENPGDRPLISSVVFVLENGSTTLPCPICPAFFTQRSVELEQIGDGILNSRNSFTLTEIE
GRSEGSNLKTQEHRQTKTGSEQIHQRQPPTKSCEICRRHISTRPLRMLGTPPGWGQGELD
LPLEAEKLGKFGSGAYGSRAPRSAHSIGATVGDALVTAELKKLNKQMKKLIELQKQGNLM
GLMAGLFCVCVIALAFVYPLLLDAIIISDGGAFALGFFAPSNSTPAKLYLGIWYNDIPEL
TVVWVANRETQLINNTSSSPMLSLTNTSNLILSDGVGGGRVVWTTQVATTPASSTSTAVL
LNNGNFVIRSPNGTMLWQSFEHLTDTLLPGMKIRFRYGIHGEEERLVSWKGSDDPSPGHF
SYGGDTNTLLQFFLWDGARPVARSAPWTGYLVKTERRYQQVNTSTEVIVSLAAVDSDKEI
YMTYSLSDGAPRTRFVLTHSGHYQHHSWSNRSLTWEVLGQWPSTECSSYDYCGPYGYCDE
TTAPVPTCKCLDGFEPAKMEEWTSGRFLSGCRRKQPLGGCGDGFLALPGMKSPDGFARIC
GSRSTSEECAAECNRNCSCVGYAYVKMSSSRSRGDVARCLMWAGGLIDTGKLGTELGGET
PYLRLAGMDVTAGKRIKGNAVRIVLPVLGSSVLVLIFLAWLKLKGKKIIRRKHKNIRLNG
MSTSDELGEEYHDQEIPFVRLEEIALATHDFSETCIIGKGGFGKVYKGILGGQEVAVKRL
SKDSHQGTHEFKNEVILIAKLQHRNLVRLLGCCGEGDEKILIYEYLPNGSLDANLFDESK
KLLLNWRTRFSIIKGVARGLLYLHEDSRLTIIHRDLKAGNVLLDADLKPKIADFGMARLF
GDNQQNANTQRVVGTYGYMAPEYGLEGIISMKSDVYSFGVLLLEVVTGIRRNSNGHTMSF
PSLTVYAWNMWKEGKTEEFADSTLLDNYSPDEVLLCIHVGLMCVQENPDDRPLMSNVVFA
LENGSTTLPTPNIPAYFARRSAEIEQIRVDIQNSVNSFTLSEIQGR
Download sequence
Identical sequences T1MUZ3
TRIUR3_21795-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]