SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_00921-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_00921-P1
Domain Number 1 Region: 501-796
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.59e-74
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 63-205
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-27
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 
Weak hits

Sequence:  TRIUR3_00921-P1
Domain Number - Region: 340-388
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000114
Family Anti-platelet protein 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_00921-P1
Sequence length 805
Comment pep:novel supercontig:GCA_000347455.1:scaffold14510:99243:101660:-1 gene:TRIUR3_00921 transcript:TRIUR3_00921-T1 description:"Putative receptor protein kinase ZmPK1 "
Sequence
MAPTLSLLLATTSIALLLFSRAVAHDALSLGSSLAVEAFQTDVLQSPDGTFSCGFYSIYT
NAFTFSIWYSKAADKTVVWSANRDRPVHVKRSVLTLQRDGNMFLIDYDGTIVWQAGGNFT
NVQHAQLLNTGNFILKATNGKTIWQSFDSPTDTILPTQHFTASTKLVPTTRSHDSGNYIF
RFSDLSVLSLIYDIPEVSDIYWPDPDQTLYEDNRNQYNNTRLGILDSNGSFGSSDFADGQ
PLVACDAGPGIKRRLTLDPDGNLRLYSLNDLDGSWSVSMAAMSQPCNVHGLCGPNGICHY
SPKPTCSCAPGYVMSNPGNWTEGCSAIVNITCDHQEPMKFVKLKHTDFWGSDQKHLLSVS
FYYCRNICMNDCTCKGFQYQEDTSSCYPKASLFSGRTYPTNDARTIYLKLPARVNVSNTI
FPRSDVFDPAPPHLDCNEMSIPPILEAHNTDVEEPKWLYFYGFIVAFFVVEVSFIAFTWF
FVLRRELRPSEVWATEEGYKVMTSHFRRYSYRELVKATMNFKVELGRGSSGLVYKGVLED
ERPVALKKLKHVSRGKEEFQAELSVIARINHMNLVRIWGFCSEGSHRLLVCEYVQNGSLA
SILFSDNILLDWKQRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLDQNFEPKITDF
GLAKLLNRGVSNQNTSHVRGTTGYIAPEWISGRPITSKVDVYSYGVMLLELLSGSRVSEL
TVGSDAEVHMVLRKLVTMLADKLEGSDESWIDEFVDCKLGGQFSYVQARTLIKLVVSCLE
EDTRKRSTMESVVQTLLSLHEDDKS
Download sequence
Identical sequences M7ZCG6
TRIUR3_00921-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]