SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_01137-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_01137-P1
Domain Number 1 Region: 479-789
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-82
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 56-148,180-209
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.85e-27
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 
Weak hits

Sequence:  TRIUR3_01137-P1
Domain Number - Region: 343-378
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0432
Family Hairpin loop containing domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_01137-P1
Sequence length 813
Comment pep:novel supercontig:GCA_000347455.1:scaffold3956:63518:66730:1 gene:TRIUR3_01137 transcript:TRIUR3_01137-T1 description:""
Sequence
MAALHVVILLSLICICRSDDRLTPAKPLSAGDKLVSSNGVFALGFFSPTNSTAGSYVGIW
YNNIPKRTYVWVANRDKPITNASSGKLVVTNNSDLVLSDSQGRTLWTTMNNFTTGATGTS
AVLLDSGNFVIRLPNSTDIWQSFHYPTDTILPGMQLPLSTDDDLYTRLVAWRGPDDPATS
DYSMGGDSSSDLQVVIWNGTRPYWRRAAWDGALVTALYQSSTGFIMTQTTVDIGGKFYLT
FTVSDGSPSTRLILHYTGMFQFLAWNSTSSSWNVFIERPNPSCDRYAYCGPFGYCDATET
VPKCNCLSGFEPDGVNFSQGCRRKEELTCGGGDSFSTLSGMKTPDKFVYVRNRSFDQCEA
ECRNNCACTAYAFSNMKNGSMSSDQSRCLIWLGELVDTGKLRDGSGENLYLRLASSTVDR
ESNVLKIALPVIASILILTCISLVWICKSRGKRRIKETKNKYTGQLSKNSKSNELENEII
ELPYICFEDVVTATDNFSDYNMLGKGGFGKVYKGRLEGGNEVAVKRLSKSSGQGADEFRN
EVVLIAKLQHRNLVRLLGYCTHEDEKLLLYEYLPNKSLDTFLFDATRDGVLDWPTRFKVI
KGIARGLLYLHQDSRLTIIHRDLKASNVLLDAEMNPKISDFGMARIFGGNEQQANTIRVV
GTYGYMSPEYAMEGSFSVKSDTYSFGVLLLEIVSGLKISSSNLIMDFPSLIAYAWSLWKD
GNARKLVDSSITEICPLHEVLRCIQLSLLCVQDDPSARPLMSSTVFMLENEKAPLPTPKE
PVYFRKRKYEIEDQRDNVEISLNGMTMTMQEGR
Download sequence
Identical sequences T1L9J3
TRIUR3_01137-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]