SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_01842-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_01842-P1
Domain Number 1 Region: 31-257
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.45e-44
Family Legume lectins 0.0001
Further Details:      
 
Domain Number 2 Region: 308-476
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5e-31
Family Protein kinases, catalytic subunit 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_01842-P1
Sequence length 541
Comment pep:novel supercontig:GCA_000347455.1:scaffold64141:68851:72940:1 gene:TRIUR3_01842 transcript:TRIUR3_01842-T1 description:"Putative L-type lectin-domain containing receptor kinase S.5 "
Sequence
MADRSMTLQLAFAAILLFILCGGGGSTCSALRFAYQSFDAASEADFSFTPGATVSNRSLQ
ITPDAGDMTHRSGRVMYARDTLKLWKNSDRTALTSFKTEFVLNIVPRNGTGEGMAFILTN
NPALPSDSSGRWLGLTNNRTDGAPANRIVALEFDTRRSFDADLDGNHVGLDLNSVRSLGQ
MPLSNFSIVLSRGADVDVTFEYDGKMMSVLVVQGGLAFTYAWYTDLSRYLLDNISVGFAA
STGEFAQLNQVKSWNFTTVDDAVARGDGGYRLRRQKVFLAVLVPLTVGVLLMALLVWRRL
TRQTRLAYRNLEKMIDAHGPVRFKLRELRNATGDFSDGRKLGRGGSGTVYLGYLRRMSME
VAVKRVSTNVNSNRGEKEFVAEVNTISKLSHRNLVKLIGWCHKKSELLLVYEYFPMGSLD
KLLYARERTASSTPATDVYAFGVFVMEVVSGRSPSNAVQYEYVHDSDHRGGGEEEYWRGG
RGRHATPMHIVDWMWRLYGEGKALHAAAPGGDKFGAWKYRCRIDVFPVVILDDQNQMYID
R
Download sequence
Identical sequences M7YY54
TRIUR3_01842-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]