SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_03058-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_03058-P1
Domain Number 1 Region: 64-161,193-222
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.96e-26
Family alpha-D-mannose-specific plant lectins 0.0019
Further Details:      
 
Weak hits

Sequence:  TRIUR3_03058-P1
Domain Number - Region: 367-400
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00706
Family Hairpin loop containing domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_03058-P1
Sequence length 443
Comment pep:novel supercontig:GCA_000347455.1:scaffold69005:64411:65808:1 gene:TRIUR3_03058 transcript:TRIUR3_03058-T1 description:""
Sequence
MDPLPIHTIICVVCWSYWLSPFCASSSSRLLPDKPLSAGSTITSDDGTFALGFFPPSSSG
TKHYYVGIWYKNIPQDNIVWVANRAMPIADPSSATLAFTNRSNLALSDTNGQLFWTTNIS
AAGNSLSEATGGEATLENNGNFILWSSQGTILWQSFDYPTDTLLPGMKLRITHRTHALQR
LISWRNPQDPSPGNFSYGADPDEFLQRFIWNGSTPYRRSPVWNKFVEVGQYIESIKSTIY
FTLQPIDDEVYISFGLPAPSVSSLVLMKMDCSGKMKIRTWNSNMSKWTDLQSEPNQECNK
FGYCGPFGYCDNTQPIVTCKCLDGFEPNNKQDWTARRFSQGCQRMEALRCAQGDGFLNVS
TMKVPDQFLYVKNRSLDECITECTSNCSCMAYAYANMGTKVINGDETRCLLWIGDLIDTE
KLIGEGENLYIRVNGFNGPVELQ
Download sequence
Identical sequences T1LEM3
TRIUR3_03058-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]