SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_03286-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_03286-P1
Domain Number 1 Region: 467-752
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.35e-74
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 40-135,167-199
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.89e-29
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_03286-P1
Sequence length 898
Comment pep:novel supercontig:GCA_000347455.1:scaffold25748:25769:31111:1 gene:TRIUR3_03286 transcript:TRIUR3_03286-T1 description:""
Sequence
MDAITSRQALVGNDRIISNNGKFALGFFQTGSKSSHNTLNWYLGIWYNNVPKLTPVWVAN
DHNPVTDTTTSELIISSDGNLVILNQVTMSIIWSTHTNTTSNNTIATLLNSGNLILQNSS
NSSNVLWQSFDYPTNTFLPGIKLGWNKVTGLNRRLVSRKNLIDLAPGRYGEELDPSGANQ
YIFTQLNSSIPYWSSGVWNGQYFPSIPEMAGPFVVNFTFVDNDQEKYFTYNLLDETIIFH
HLLDVSGQTKSFLWLESSQDWVMTYAQPRVQCDVFAVCGPFTICNDNTIPFCNCMKGFSI
RSPSDWELDDRTGGCVRNTPLDCGINKSISEEDRFYPITCVGLPNNGHSTEDATSEDKCT
EVCMGSCTCTAYSYGVNGCFIWNGEIINVKQQQCDDTTNTNKATLYMRLANREVQRLESN
RRRIIIGTAIGASVAFCGLLSLFLLLMIKRNKRLSAHRMENLQGGGGIIAFRYVDLQRAT
KNFSEKLGAGGFGSVFKGFLDDSTAIAVKRLDGACQGEKQFRAEVRSIGFIQHINLVNLI
GFCTEGDGRLLVYEHMQNRSLDAHLFHNNGTILKWSIRHQIALGVARGLVYLHDSCQDCI
IHCDIKPENILLDASFVPKIADFGMAKFLGRDFSRVLTTMRGTIGYLAPEWISGTVITAK
VDVYSYGMVLLEIVSGKRNSGRQYTTGDDYVYFPVQVANKLLEGGVGSLVDINLHGDAHL
EQVERALKIACWCIQDDEFDRPTMGDVVQSLEGLLEVNIPPMPRLLQAIAGNQHSTSHSF
RAFNPTTTTVTPERQKLYYLRPRGFGTPPQWWRHWHPVGGDVSVEGNYGDFVNLKMICRL
SLLKATTFSNPTSFVSSSRTNSHARSSILHMTHLATKLTMEDEEVDDDIALGARTLES
Download sequence
Identical sequences T1LF77
TRIUR3_03286-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]