SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_05035-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_05035-P1
Domain Number 1 Region: 323-497
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 0.0000000000000093
Family Plant cytotoxins 0.041
Further Details:      
 
Weak hits

Sequence:  TRIUR3_05035-P1
Domain Number - Region: 48-100
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 0.00262
Family Plant cytotoxins 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_05035-P1
Sequence length 548
Comment pep:novel supercontig:GCA_000347455.1:scaffold8684:61230:65236:1 gene:TRIUR3_05035 transcript:TRIUR3_05035-T1 description:"Uncharacterized protein "
Sequence
MGRFMAELLLLLALVASNSWHGAVVGLHGHGVADDKASVVMPKHDISLASFTDKSSSYLG
LIGGLANLPLGRNTMVYAAPVLSAYDLAADAKPVKRALAMGALVDFAHEKAKNTVGAVTS
NEGKPGDKSRLVPGKRTICSCKETFDDTLVLAGKPTTLSEQPIRKGKASQYLSLLHGSKQ
VLTARDKQGSAYGVMTGSAGMIYEAVLTAFAAAAIIACGCWGIVTRTSLSQKERTVLVLV
LILSSMTHVGCVDDGDDDDYEDPDPNPPVQGGGAGNNPQPGAAPTQIEGLVNVAVDFHMS
DEAGGALFLIQYEEQMGDNTEPITGGHYITPPEVAKPLRWITVGLPLPDTQVFASLLVRG
DKGYNMGFINGYGLACCTSDAKGDKVFPFDVEGCEDLGFASDYRGLTDTPKGDINAALEI
EIGQDVALKAARVLAEYGHSHRAKELTRQAMRDLTVMVCEGPRINRIGDIMKHRWTTRTR
LVKDAVRLIFKWKLMSVHKCIGKDMVGKVNGGWKLIAIGIKTLVDIDRELGMVKYSRACD
RIRFPRQN
Download sequence
Identical sequences M7ZES1
TRIUR3_05035-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]