SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_06533-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_06533-P1
Domain Number 1 Region: 1-293
Classification Level Classification E-value
Superfamily Carbamate kinase-like 1.83e-62
Family PyrH-like 0.00000000165
Further Details:      
 
Domain Number 2 Region: 387-460
Classification Level Classification E-value
Superfamily ACT-like 1.02e-16
Family Aspartokinase allosteric domain-like 0.00027
Further Details:      
 
Domain Number 3 Region: 299-401
Classification Level Classification E-value
Superfamily ACT-like 0.000000000000295
Family Aspartokinase allosteric domain-like 0.0000809
Further Details:      
 
Domain Number 4 Region: 534-622
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 0.00000000712
Family Plant cytotoxins 0.032
Further Details:      
 
Weak hits

Sequence:  TRIUR3_06533-P1
Domain Number - Region: 766-813
Classification Level Classification E-value
Superfamily ACT-like 0.000572
Family Aspartokinase allosteric domain-like 0.0013
Further Details:      
 
Domain Number - Region: 733-759
Classification Level Classification E-value
Superfamily Carbamate kinase-like 0.0823
Family PyrH-like 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_06533-P1
Sequence length 814
Comment pep:novel supercontig:GCA_000347455.1:scaffold11362:37944:48810:-1 gene:TRIUR3_06533 transcript:TRIUR3_06533-T1 description:"Aspartokinase 1, chloroplastic "
Sequence
MREVADLILSFPEETPVVVLSAMGKTTNNLLLAGEKAVSCGAPKASEINELAVIKELHLR
SVSVPWFALLRTIDELGLDSSIVSGFLDELEQLLKGVAMMKELTLRTRDYLVSFGECMST
RIFAAYLNKLGKKARQYDAFDLGFITTDDFTNADILEATYPAVAKRLHGDWIDDPAIPIV
TGFLGKGWKSCAVTTLGRGGSDLTATTIGKALGLREIQVWKDVDGVLTCDPNIYANAVPV
PYLTFDEAAELAYFGAQVLHPQSMRPAREGGIPVRVKNSYNRHAPGTVITKTRDMRKSIL
TSIVLKSNITMLDIVSTRMLGQYGFLAKVFSAKVFSIFEDLGISVDSVATSEVSISLTLD
PSKLWSRELIQQELDHVVEELEKIAVVHLLQHRSIISLIGNVQRSSLILEKAFNVLRRNG
VNVQMISQGASKVNISLVVNDSEAKQCVQALHSAFFENGFLSEVEEADLAQNRVPVLPRL
CRSLVKMAIRPRLFRPPELIHWCCKSGIIVIIGVVRACYLLNLTIGDLKKVMKFNVLSDR
YIMFMSTLRAKLLVPNQEKVKKRPVLLVKQTKDNQPPPWWVEVELVGKGGASPKVSVRSD
NTYVFAFTNFEGKLFNLTDGRTNDAFGSLSGNIFVPTRRQYFRRPPTNADKVKQRWQSLV
PAPSRLVPDLMPHVLHDDGSCHLVPVPYLTFYEAAEVAYFGAQGVGCVGRDLYSTDNFLL
YVFLELLVLLGDLATREGGMPVRVKNSYNCHAPGTVITKTRDMRKSILTNIVLKSNIAML
DMVNTRMLGQYGVLAKVSSAKVFSIFEHLGISVE
Download sequence
Identical sequences M7ZTC5
TRIUR3_06533-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]