SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_06665-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_06665-P1
Domain Number 1 Region: 209-513
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.16e-78
Family Protein kinases, catalytic subunit 0.0000947
Further Details:      
 
Domain Number 2 Region: 17-251
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-64
Family Legume lectins 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_06665-P1
Sequence length 557
Comment pep:novel supercontig:GCA_000347455.1:scaffold79752:14040:15710:1 gene:TRIUR3_06665 transcript:TRIUR3_06665-T1 description:""
Sequence
XRSLGILNVTDNGKPDNGVFAVELDTMLNPEFQDMNSNHVGVDLNSLRSVQNHSAGWYDD
ATGVFNNLSLISRRPMQVWVDYDGATTRLDVAMAPLDVPRPRKPLISAPVNLSAVVTDTA
YVGFSAATGVIFTRHYVLGWSFALNGPAPPLDTSKLPSLPRFGPKPRSKVLEIVLPIATA
AFVLALAIAFFMFVRTRIRYAEVREDWEVEFGPHRFAYKELYKATKGFKNRRLLGTGGFG
RVYKGVLPRSNLEIAVKRVSHDSKQGMKEFIAEVVSLGHLRHRNLVQLLGYCRRQGELLL
VYDCMPNGSLDKYLHDKTRPVLDWSQRFQIIRGVASGLLYLHEDWDKIVIHRDIKASNVL
LDADMNGRLGDFGLARLYDHGVDPQTTHVVGTMGYLAPELVRTGKATPVTDVFAFGVFVL
EVTCGRRPLGCIAPDDQNVLLDWVQEHERRRAGLDTVDPRLCGKYDADEARLAIKLGLMR
AHPLPDARPGMRQVTQYLEGEVAMPEAVPTFLSYTTLALMQNDGFDSFAMSFPSTVTTDA
SPTSGDVSAVSGLSGGR
Download sequence
Identical sequences T1LP62
TRIUR3_06665-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]