SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_08060-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_08060-P1
Domain Number 1 Region: 587-830
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.32e-55
Family Protein kinases, catalytic subunit 0.0012
Further Details:      
 
Domain Number 2 Region: 160-255,287-316
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-30
Family alpha-D-mannose-specific plant lectins 0.0018
Further Details:      
 
Weak hits

Sequence:  TRIUR3_08060-P1
Domain Number - Region: 450-507
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00255
Family Pan module (APPLE domain) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_08060-P1
Sequence length 891
Comment pep:novel supercontig:GCA_000347455.1:scaffold4885:136390:141574:1 gene:TRIUR3_08060 transcript:TRIUR3_08060-T1 description:""
Sequence
MAPLSQCPTWRRVGGSLGRSSSFPAAQAAAYPSVTTQGLMVIVRMFVGRCTQGSCHCQDV
SLNSFVVTISAVPPRQGATHSVLLISGRLFPRLLNFNMLLHPLLLGFIFTLHIHASSAAI
DSIAPGQRLVCGVSDKLVSLNGKFAAGFFQTGSKSHDTLNWYLGIWFNKVPKITPVWLAN
RDDPITQPALVRFIISEDGNLVILDQATNSMIWSSGVSIRTNTTIALLMNNGNLVLQNAS
NSSDILWQSFDHPTNTFLPDAKIGRDKVTGLTRRLVSSKNSIDPARGRYCNELVPNRLIL
TLLNSSIVYWSSGEWNGQYFSTIPEMLSHNLIDFKFVNNTNEEYFTFSLLNDTMIMHHLL
DVSGQLKTLIWDEVSQDWLGSYSNPRAQCDVYALCGPFTVCDDNSAPYCSCMKGFSIRSP
EDWELNDRSGGCVRNTPLNCGSNRSTAGMTDKFYSLSNVKLPRNSGNVGAATSDRECAEV
CLRNCSCTAYSFTYSTCSIWHEELVNVKQQHADTTDTNDSAVYLRLAAKEMQNQKPGRRV
TIRILAVTIVSALGLLALILLVVLLMIRRNNRGWSGGTLKNPQDGGGIIAFRYTDLQRAT
RNFSEKLGAGGFGSVFKAYLTDSATMAVKRLDGACQGEKQFRAENNNTVLNWCTRYKIAL
GVARGLTYLHESCQDLIIHCDIKPQNILLDKSFVAKIADFGMAKLIGRDFSRVLTTARGT
VGYLAPEWISGVAITPKVDVYGYGMVLMEIISGRPNSLEQYTAGGDCDVFFPVHAAHMLL
EGDVASLVDDKLSGDVNLEEAERLCKVACWCIQDDEFDRPTMGEVVRALEGLSDLDMPPI
PRLLQEYIFVLAALFALLRGDFVRFFTGMKSSNRMKSARAAAGFKHTTFYD
Download sequence
Identical sequences T1LSX1
TRIUR3_08060-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]