SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_08474-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_08474-P1
Domain Number 1 Region: 509-806
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-73
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 65-211
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.05e-26
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 
Weak hits

Sequence:  TRIUR3_08474-P1
Domain Number - Region: 345-392
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00018
Family Pan module (APPLE domain) 0.084
Further Details:      
 
Domain Number - Region: 217-281
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0669
Family alpha-D-mannose-specific plant lectins 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_08474-P1
Sequence length 814
Comment pep:novel supercontig:GCA_000347455.1:scaffold34987:34073:36517:1 gene:TRIUR3_08474 transcript:TRIUR3_08474-T1 description:"Putative receptor protein kinase ZmPK1 "
Sequence
MVPVLPTHLATVSLLSFVALVSSAANRDILRPGTSLAIEAYQSEILQSPDGTFSCGFYGV
YDNAFTFSIWYSKAANKTVVWSANRDRPVHSRRSALTLHKDGNMVLTDYDDAVVWQADDD
GNSRRNVQHVQLLDTGNLVMKNTSGTIIWQSFDSPTDTLLPAQRITAATKLVPTTQSRAP
GNYIFRFNDISVLSLIYDVPEVSDIYWPNPDNSVYENNRSRYNSTRLAILDNNGILASSD
FADGVLLKASDAAPGIRRRLTLDPDGNLRLYSLNDSDGVWSVSMVAISQPCTIHGICGQN
GICHYSPEPTCSCPPGYVMTNPGNWTQGCTASFNIPCHDQEPMKFVKLPHTDFWGSDQKR
LLGVSFEACRNSCINDCTCKGFQYQQGAGSCYPKALLFNGKSCATPSVRTIYLKLPARLS
VSGTPIPQSNVLDPAPPRLDCNQMSKGIRHPFPDLRKTGDEELNWIYLYSFIVAIFVFEV
SFMTFAWFFVLRREMRPSEMWAAEEGYRVMTSHFRRYSYRELVEATRKFRVELGRGSSGT
VYKGVLEDERPVAVKKLENVSRGKEEFQAELSVIGRIYHMNLARIWGFCSEGSHRLLVCE
YVENGSLANILFNDQKTVVLDWKQRFNIALGVAKGLAYLHHECLEWVIHCDVKPENILLD
TNFEPKITDFGLAKLLNRGGATQNMSQVRGTIGYIAPEWVSSLPITAKVDVYSYGVVLLE
LLSGTRVSELAVGSGAEVHGMLQKLVRVLADKLGGHEESSINEFVDPELGGRFSYVQART
MIKLAVSCLQEDRNKRPTMESVVQTLLPFDEASS
Download sequence
Identical sequences M7ZA47
TRIUR3_08474-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]