SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_09841-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_09841-P1
Domain Number 1 Region: 70-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.84e-27
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_09841-P1
Sequence length 347
Comment pep:novel supercontig:GCA_000347455.1:scaffold66474:12173:13717:-1 gene:TRIUR3_09841 transcript:TRIUR3_09841-T1 description:"Receptor-like serine/threonine-protein kinase SD1-7 "
Sequence
MASLPAIFILMLLVCSCNSNDRLTPTKPLSPGDELISSNGLFALGFFSLQSSAANTYLGI
WYHNISERTYVWVANRDNPITSSLPGKLVVSNTSDLVLSDSDGRVLWATKTKTNNVTTAG
SGGRGAVAVLLDTGNFVLRSRNGTEIWQSYDQPTDTFLPGFKLWVNYKTHVAARIVAWKG
PDDPSTGEFVLSGDTSTGLQILTWRGSSLYWRVGVWSGATAASFTKSFLSQMIDDGEVAY
FTYNRADDSAPARSHWKLDHTGEVMFSGVWEGSPSSSWVPLFERPGKGCLVYGACGPFGY
YEVKGAVRECRCLVGFEPADGGDSSKAGCVRKEALRCGGNNYFRPSK
Download sequence
Identical sequences M8AJK2
TRIUR3_09841-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]