SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_10919-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_10919-P1
Domain Number 1 Region: 409-693
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-75
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 300-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.021
Further Details:      
 
Domain Number 3 Region: 247-343
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000188
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_10919-P1
Sequence length 760
Comment pep:novel supercontig:GCA_000347455.1:scaffold41802:32648:35748:-1 gene:TRIUR3_10919 transcript:TRIUR3_10919-T1 description:"Wall-associated receptor kinase 3 "
Sequence
MERVASRQMPFPAVVAAVLLELLSAVVTAAGCSTSCGNISIPYPFGIEPDCYHEGFNLTC
DYLYRPPKLFLGDGTVEVLEISIPNGTVRINSTNIMPMSHDIDGASRPNTSRYHTWGGLR
ERGPFFVAPDRNEFLVLSCNNIQVILMGEDNSTINACATYCPSLGNSDAQPQLIRYLLLH
GECSGLGCCNGGIPKGYTSYHIQLQPSNDSSSDAKSSVYIAEEGSYNISKLMSEPRGVAL
PALLDWVISNSSCQKQNSVAPGCRSSNSFCQNYTSYVYNGYQCRCSAGYRGNPYILDGCQ
DIDECVHKEAHSCHGICENTPGTFYCRCPDGTYGNPSIEGGCIKITNYSAGLIIGIVISG
VSILLLALSAPFVTRMVKLRKVKKMREKLFNQNHGLLLQQLISQKADIGERMMFTLGDIE
KATNNFDKSREVGGGGHGVVYKGILDLHVVAIKKSKIVVQREIDEFINEVAILSQINHRN
VVKLLGCCLETEVPLLVYEFISNGTLYHHLHVEGPKSLSWDDRLRIALEIARALAYLHSA
TSMPIFHRDIKSSNILLDESLIAKVSDFGASRYIPIDQTAVMTAVQGTLGYLDPMYYYTG
RLTDKSDVFSFGVLLIELLTRKKPYVYRSDNDAGLVAHFVSSLKKGDLADIVDPQVMEEE
DDGELQEVAMLAAMCTRLEGESRPTMKEVEMALENLRARKKPAPCNSAAMRYDGDQIVVQ
YNSIEDLLAKKDMPVEGGAEESSRQYTMEEEIMLSARYPR
Download sequence
Identical sequences M8AT06
TRIUR3_10919-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]