SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_14786-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_14786-P1
Domain Number 1 Region: 285-598
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.5e-84
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 2 Region: 24-264
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.21e-63
Family Legume lectins 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_14786-P1
Sequence length 623
Comment pep:novel supercontig:GCA_000347455.1:scaffold6053:8730:11008:1 gene:TRIUR3_14786 transcript:TRIUR3_14786-T1 description:"L-type lectin-domain containing receptor kinase IV.1 "
Sequence
MLLHPHHLVPLLLLLVAAASGDGVQFSYNGFAGVNLTLDGAVVMPNGLLMLTNGTIQTKG
QAFHPSPLPFRGGGEANGTGDGAARSFSTTFVFAIFGQYADLSSHGMAFFVSASRELLST
AMPGQFLGLLNDTDGGNRSDHIFAVELDTLFNAEFRDINSNHVGVDVDSLVSVRSADAGY
YDDGTGTFRNLSLISREAMQVWVDYDGGATEVAVTVAPLGMARPKKPLLTTTVDLSPVVQ
STMLVGFSSATALAALVLVLGIGVYIFVRRLVKFSELREDWEDAFGPHRFSYKELYHATK
GFSDKNLLGAGGFGSVYRGKLRKPDMEVAVKRVSHESRQGMKEFVAEVASIGRLRHRNLV
PLLGYCRRKGELLLVYDYMPNGSLDKYLYDASSTGTLDWPQRFHIIRGVASGLLYLHEDW
EQVVIHRDVKASNILLDSEMNGRLGDFGLARLYDHGTDAHTTHVVGTMGYLAPELGHTGK
ATPSTDVFAFGAFLLEITCGRRPIEQNEHDNRIVLVDWVIEQWRKGLIIGAVDTRIPSGF
SPDMVSLVLKLALLCSHPLPNGRPTMRQVMQYLDGDMVLPDLSSAYLSFTMLERMYDGDF
NQKMLPYESSTSMGAVSDISGGR
Download sequence
Identical sequences M7YU88
TRIUR3_14786-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]