SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_18294-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_18294-P1
Domain Number 1 Region: 90-162,262-289
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000341
Family alpha-D-mannose-specific plant lectins 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_18294-P1
Sequence length 371
Comment pep:novel supercontig:GCA_000347455.1:scaffold6968:211623:214532:-1 gene:TRIUR3_18294 transcript:TRIUR3_18294-T1 description:""
Sequence
MREGKPDPAIAVFLIALFVASAVPLINGADGEEPVTQLSNGFTATHLADAPGRFEPVLYS
HNGVFAFGFLRVGSASLDLAVVHLPSSFPLWRATPDRVADWSRPATLSFDSRLVLTVPRV
GELWSTLNVVGDTVALLNSSDLVIRLFNGRGTPWRSFENPSDTLVLGQNFTMSSPPLISK
NRRFSLRFAKTYMALYMEFYGGSKRPMYWQYTAREAQPENATQPPVYGRLDSRGFFGFYL
LGGDQSVDMLAFDTFVRNLTGAFRRMTLDDDGNLRAYYWTEGSKAWTSDYKAISGPCELP
TSCGAYGLCVPGGAPRRSLSYYVPHQGMQIFVKIHVTEDQNIREENVVSDVRQGMLAVQA
CKGATPHMLRL
Download sequence
Identical sequences T1MKG5
TRIUR3_18294-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]