SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_22043-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_22043-P1
Domain Number 1 Region: 255-334
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000115
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 2 Region: 97-119
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000235
Family CCCH zinc finger 0.0051
Further Details:      
 
Weak hits

Sequence:  TRIUR3_22043-P1
Domain Number - Region: 199-225
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000235
Family CCCH zinc finger 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_22043-P1
Sequence length 390
Comment pep:novel supercontig:GCA_000347455.1:scaffold65675:29950:32340:-1 gene:TRIUR3_22043 transcript:TRIUR3_22043-T1 description:"E3 ubiquitin-protein ligase makorin "
Sequence
MSNRYRDFSAPLARSGAPRPMIRAGLDGVVELGGGIGACNERSGFGLDLAYCATFVVFIA
DQGLVQMQWYHAYNLAPGCNSVGENEGDGDFCRNRTVVTVCTFYQNGVCSYGSRCRYEHV
EVSSEYTQPSTTAALAPSNSYLSWCPLCEGEIDVSNQTHKSLSVCSVHQSTWRFDDEDCI
PEDGNSLSSALTAQNQALHPLAHLPICSFAAAGTCPYGKDCPQMHGDPCTTCGKQCLHPY
RPSEGGAHIKLCKRNNKRLETLKKSEEMECSVCLDRVLSKPTAAEKRFGLLPECDHAFCI
TCIRKWRSSSLTSSMDIDSTVKACPICRKVSYYVIPSATWYSSKEEKQDIIDGYKAKLKS
IDCRYFDFGRDTCPFGGRCFYKQQFRMKPN
Download sequence
Identical sequences M7ZC25
TRIUR3_22043-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]