SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_22603-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_22603-P1
Domain Number 1 Region: 240-535
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.96e-69
Family Protein kinases, catalytic subunit 0.00031
Further Details:      
 
Domain Number 2 Region: 29-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.81e-55
Family Legume lectins 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_22603-P1
Sequence length 572
Comment pep:novel supercontig:GCA_000347455.1:scaffold27792:64438:66432:-1 gene:TRIUR3_22603 transcript:TRIUR3_22603-T1 description:"L-type lectin-domain containing receptor kinase IV.2 "
Sequence
MDNLRSLLAALLLVCFGFGAGVLGDGDGEQFVYSGFAGANATLALDGTALVQPSGLLELT
NGTAQLSSHAVHRTPLRLRRSPGDAVRSFSASFVFGIIPPYSELSGHGIVFFVGKDNFSA
ALPSQYLGLLNSANNGNATNQIFGVELDTIQSTEFNDTNDNHVGIDVNSLKSVAAHSAGY
YDDETGAFNELLLISGKAMQVWVDYESDSTQISVFLAPLKNGAKPSTPLVYAEVREEWEV
EFGPHRFTYKDLFRATEGFKNKTLLGFGGFGRGYKGALPKSKLEVAVKKVSHESRQGIKE
FVAEVVTIGRLRHRNLVQLLGYCRRKGELLLVYDYMSNGSLDKYLYSGSKEKPALDWAQR
FRIIKGVASGLLYIHEDFEQVIIHRDIKASNVLYDHGPDPQTTHVVGTMGYLAPELARTG
KASPLTDVFAFGAFILEVACGRRPVEQAMNDSRLMLVDWVLEHWQKESLLEVVDARLDGN
YDAGEVVLALKLGLMCSHPMPGARPSMRQVMQYLEGDMPIPELTPTQMSFSMLALMQSQG
FDSFVLSATSDPSSATNTMMTMGTISGLSGGR
Download sequence
Identical sequences M7Y717
TRIUR3_22603-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]