SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_23321-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_23321-P1
Domain Number 1 Region: 230-512
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-68
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 4-155
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.35e-36
Family Legume lectins 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_23321-P1
Sequence length 565
Comment pep:novel supercontig:GCA_000347455.1:scaffold72376:4103:5942:-1 gene:TRIUR3_23321 transcript:TRIUR3_23321-T1 description:""
Sequence
APAGAPVSFSTTFVLAIAPRYPDAHGHGIAFALAPSVNVSGAVAGKYLGLFNTSNSLGSG
TSQIVAVELDTVMDMEFQDADDNHVGVDVNSLHSVNSATAGYWHDDGSGGRRFDNISLTG
GSNAPVQVWIEYDGDSPRLQGKLSHYVLGWSFRLGGGRAPDLDLSKLPSPPSPRSPKRRM
PHLLLLALLLLAVVVLLLVSAAIGVLVMRRRQQRWQFAEEDEEGWEMIDYSPHRISYKDL
HDATNGFRDVIGVGGFGRVYHGVLPRSGVEVAVKKVSHRAGLRPRNLVQLLGYCRRRDEL
VLVYDYMPNGSLDQHLFGRAAPGLSWEQRAKIVRGVAGGLLYLHEGWEQVVVHRDIKAGN
VLLDADMNGKLSDFGFARLYDHGGDPHATHVVGTLGYIAPEMSKTGMATTSSDVFAFGAF
LLEVACGRRPVVFSNNDSEDSPPSPGLVELVLGHWKAGKITEARDPRMGKCDEDDLELVL
KLGLLCSPPAPPRRPSMRQVVQMLEGAAPAPETSPEDLGNSMTLFEHSEAFDGFVGVSFP
STSGFTTATMRTSASNSPDEKRQLL
Download sequence
Identical sequences T1MZ40
TRIUR3_23321-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]