SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_27675-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_27675-P1
Domain Number 1 Region: 71-181,213-228
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-20
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 
Domain Number 2 Region: 492-549
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000193
Family Protein kinases, catalytic subunit 0.0086
Further Details:      
 
Weak hits

Sequence:  TRIUR3_27675-P1
Domain Number - Region: 371-414
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000804
Family Pan module (APPLE domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_27675-P1
Sequence length 549
Comment pep:novel supercontig:GCA_000347455.1:C167251877:621:2363:1 gene:TRIUR3_27675 transcript:TRIUR3_27675-T1 description:""
Sequence
MPLLYILVLGLLLSHTPRCCSSAPARDTLTEGQVLAVGDKLVSTNGKFALGFFQPAASTV
SKSRNSTGSSWYLGIWFNKIPVFTVVWVANREEPIPHLNMNSTKLKFSSDGKLVIVTNRA
DAVTESLVWSTHIVNRTQSSSINTSTSSVVVLLNSGNLALKVTDSPSSDLLLWQSFDYPT
DVGLPGAKLGRNKVTGFSRRFISKKSLIDLGLGSYGMEVENTSGIVLKRRNNPVVKYLIY
ATSGSSSLIPMLKSLLDLDPRTKDISGQVKLNIWSQANQSWQTIYSEPADPCSPPATCGP
FTVCNGIAHPSCVCMESFSHKSRHDWEFEDRTGGCIRNTPLHCSTSGNSKNMTSSTDMFH
PIAQVALPYNPQIIDVATTQSKCEEACLGSCSCTAYSYNNSRCSVWHGELLSVNLNDGIE
NNSKDVLYLRLAAKDLLPGSRKRKRKPKVGVVTIVSIIGFGLLMVMLLLLIWRNKFKCCG
LPIYDNLGSAGGIVAFRHTDLVRATKSFSEKLGGGGFGSVYKGVLNDSTSIAMKRLDGAR
QGEKQFRAE
Download sequence
Identical sequences T1NAZ0
TRIUR3_27675-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]