SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_28045-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_28045-P1
Domain Number 1 Region: 264-369
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.33e-30
Family Protein kinases, catalytic subunit 0.0015
Further Details:      
 
Domain Number 2 Region: 12-135
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000186
Family Legume lectins 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_28045-P1
Sequence length 483
Comment pep:novel supercontig:GCA_000347455.1:scaffold58557:55335:58398:-1 gene:TRIUR3_28045 transcript:TRIUR3_28045-T1 description:""
Sequence
GSLDILDAGSVTEFSFSNFHPEYRGKNLTVVGDADITKGALQITPDTGNEAAHFLTNKSG
RVLYYAPVRLWRLEKGGGKGNASAGGKNVASPVLAAPLDLGATVAERSYLGFAASTGTKY
QLNCVLAWNMTVEKLDEPSNNRGLILGLAVGVLALGAAAALGYYVCVVRRRKLGRDQGSX
CLKLLFVMGHMYPYATIVHALINNLILPLLNKKNILLNYHTGWFHFFRKEKHWMVSWIHL
ITSNAHHDLSIRFIIKNKKQKIYIFLWWSHDNGELLLVYEYMSNGSLDQHLFSSAPGSRP
GQPLGWELRYGIVQGVASALHYLHDQFDQRVVHRDLKASNIMLDAAFTARLGDFGLARAI
ETDKTSYTEEAGGGVHGTGGDHPPRXRLLMLGLACSHPTPAERPKAQAISQILLRSMPTP
AVSPFKPSFVWPATDGGFDTMSTTAGSTSSTVVTSTSTWSGNFARGSQNHAPAPEQDTSG
SLV
Download sequence
Identical sequences T1NBZ0
TRIUR3_28045-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]