SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_29867-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_29867-P1
Domain Number 1 Region: 460-749
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-70
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 74-179
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.27e-26
Family alpha-D-mannose-specific plant lectins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_29867-P1
Sequence length 767
Comment pep:novel supercontig:GCA_000347455.1:scaffold3067:13301:17792:-1 gene:TRIUR3_29867 transcript:TRIUR3_29867-T1 description:""
Sequence
LLVHDQLLLITLFLLSVQTTAASGARDRFEKGQNLTDGDTLVSPDGSFTLGFFSPGASTK
RYLGIWFSVSNDTVCWVANRDQPLPDKSGMLVFDDLSSLVLVDGSRRTVWSPNFMAASAA
VVQLLDSGNLVVHNGSSSAALWQSFDHPTDTLLPDMKLGKDLWTGAEWQLTAWRSADDPS
PGDYRRTLETKGLPDIVLWQGDVKRYRTGPWNGLYFNGVPEVTAYADKYTLRGRRGAEVT
YGYTAKPGAPLTRVVVNYTGDVERLMWDAGTRAWKPLFKGPRGHAALDCAGGATTDGFAV
VRRVKLPDTQNASVDMNVTLEGCRARCFADCSCRAYAAADIRGGGDGTGCVMWADAIVDL
RLVDRGQDLYLRLSKSEFVHRFAAITDDQKEFPTLLVVAPVASGVIVLLVVSLIWWRRKR
RIIGNRDIMLLGIQTGLGICGKPNMPTIREGGAIPQNPAMAVPSVNLSIIKDVTGNFSES
NIIGQGGFSIIYKGLLPEGRMIAVKRLKQSALTTKGKKDFGREVEVMAGLRHGNLVRLLA
YCNEGKERILIYEHMQNKSLNVYIFGIPKLRALLSWTRRLELLHGIAHGVAYLHGGSGES
VIHRDIKPGNILLDDEWKPKIADFGTAKLFVVDQAGPDQTIVVSPGYAAPEYARRGDMTL
KCDVYSFGVVLLETISGERNGGLHRLLSHAWELWEQNRTMELLDTAVVPLAKSEPELLSE
LKRCIQIGLLCVQETPCERPTMSTVVAMLTSTASQIDRPRRPVLDSG
Download sequence
Identical sequences T1NGW2
TRIUR3_29867-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]