SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_31647-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_31647-P1
Domain Number 1 Region: 555-769
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-66
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 117-260
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-26
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  TRIUR3_31647-P1
Domain Number - Region: 388-436
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000192
Family Pan module (APPLE domain) 0.034
Further Details:      
 
Domain Number - Region: 520-554
Classification Level Classification E-value
Superfamily Peptide methionine sulfoxide reductase 0.0144
Family Peptide methionine sulfoxide reductase 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_31647-P1
Sequence length 771
Comment pep:novel supercontig:GCA_000347455.1:scaffold80668:9994:15162:1 gene:TRIUR3_31647 transcript:TRIUR3_31647-T1 description:"Putative receptor protein kinase ZmPK1 "
Sequence
MARQRDSFGIDSRRKRGDVDDEAVYMSPTTGWIIIVRCEFLLKNGEDCLSICSNKIHILP
SLPFLFDSNNWDHADNLSREFLLPGSSLSIEDSSHMLRSPDGTFTCGFKNISRNASVFSI
WFSNTVDKTVVWSANHLHPVYSWGSRVMLYADGGMVLEDYNGQSVWENNVNSSSKAVKAQ
LLDTGNLIVKGQGDIILWQSFHSPTDTLLPYQNITSATKLVSTSRLLVPGRYSFHFDDQH
LLTLFDDEKDISFIYWPNPNSDIWTKQRNSFNTTTIGVLDSWGYFLGSDNLNFKASDWGI
RIMRRLTLDYDGNLRLYSLNKTDGTWLVTWMALPQTCSIRSLCGTNGICVYTPRPSCACA
PGHEIIDPNDRSQGCRPKFNTSCDGQEMFVKLPNTDFRGNDQSKNTSVSFHTCKKICLND
CNCKGFLYWQASGGCYPKSSLLGGEMRPGLGRSIYIKLPKTLQVSKSSIPQSQPFDPRYA
PNCSAKTKYSIPEFLDQPKDSHSGLNSQYLYLLYGFLLAIFCVEVIFVALGCWFLLRREG
KQLPGVWLAEIGYEMITNHFRGYTYKELQRATQKFKDQIGCGASGHVYKGVLKDKRVVAV
KRLADINQGGEEFQHELSVIGKIYHMNLVRVWGFCSDGPHRILVLEYVENGSLDKTLFSS
TRLLEWKERFNIAIGVAKGLAYLHHECLEWVIHCDLKPENILLDDNLNPKISDFGLAKLV
SRGGSNENVSKIHGTRGYIAPEWVSSQPITAKVDVYSFGVVVLELLKGARV
Download sequence
Identical sequences M8AAR3
TRIUR3_31647-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]