SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_32596-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_32596-P1
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily At5g01610-like 1.19e-25
Family At5g01610-like 0.0000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_32596-P1
Sequence length 119
Comment pep:novel supercontig:GCA_000347455.1:scaffold66747:31676:32681:-1 gene:TRIUR3_32596 transcript:TRIUR3_32596-T1 description:"Uncharacterized protein "
Sequence
MDEIMNKMGSYWLGQRANKEMSSAGDDIETRRLTVHIPAVCEVGYRDGSELRFDTTVTGT
LDKGSLTGVEGLKAKVLVWARVTAVKADAAKVYFAVGIKKSRSREAYEVVRGAITVDEF
Download sequence
Identical sequences M8A4A9
TRIUR3_32596-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]