SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for TRIUR3_34810-P1 from Triticum urartu 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  TRIUR3_34810-P1
Domain Number 1 Region: 1393-1693
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-78
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 479-749
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-73
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 3 Region: 961-1064,1096-1127
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.14e-20
Family alpha-D-mannose-specific plant lectins 0.0048
Further Details:      
 
Domain Number 4 Region: 48-151,183-213
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.53e-20
Family alpha-D-mannose-specific plant lectins 0.0063
Further Details:      
 
Weak hits

Sequence:  TRIUR3_34810-P1
Domain Number - Region: 1276-1309
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00179
Family Pan module (APPLE domain) 0.053
Further Details:      
 
Domain Number - Region: 344-400
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0049
Family Anti-platelet protein 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) TRIUR3_34810-P1
Sequence length 1694
Comment pep:novel supercontig:GCA_000347455.1:scaffold34620:1965:23332:1 gene:TRIUR3_34810 transcript:TRIUR3_34810-T1 description:""
Sequence
LCFATAPAVGAAATLSAWRPLRGNHTMVSAQGKFELALFSPAGSSGDRFYLGIWYKKIPG
QTIIWVGNRASPLSAVTSAEFRVSADDGNLELVGPAGASTSPVVVWSSNLSFALSPGSNN
TAEIHDNDNLVLVDGRNSSNVLWQSFDHPTDTLVPEAWIGENKLTGEYQALTSWRNAQDP
APGIFSGTLDPKGASEVFYMWNRSRVYWRTGVWTGQAFAKLPEATKNTIYNGTYVETPAY
RRVINVLYDNATITRSVLDPTGQAQMYIWMPTSRSWQLLWTGPMLQCDVYALCGAFGVCD
EGGKLPCHCPPGFAPVTEGDWTLNDWSGGCCRSSPLRCAHNGSRTGGFVMLPDMKLPDDS
LTVGVAQSKVECESACLKSCSCQAYAFSAGECIVWYGELRNLQQLYLEYDSPGSNLYLRL
SERGLQDLHSVDREKMGRKLWFVLGIILAGVVAVGASVLLGWRIVRTRRRLVSMANENVS
SLAVYSYGDLHAATKDFSERLGRGSFGSVYRGVLNRHKGDNSIRVQVAVKKLESLGRQGD
KQFRTEVSTPGCIQHVNLVRLLGFCSSDDDKMLVYEYMPRGSLDGLLFRDGACMSWRDRY
CIMLGVARGLAYLHHGCRDCIIHCDIKPENILLDEDMSLRIADFGMAKLVGRDFSRALTT
MRGTIGYLAPEWISGQPISAKADVYSFGMVLFELISGVLEGEVGAVADLRLRGDVMPKEL
ERACRAACWCIQDEEAQRPTMAQVVQALEGVVHNQAPPVPRTLEHLVTLVDLLPIGPYRT
DLGHVVGVSLCVPRLYHGPGLLSALRQADIFHNRKRLRAPFSCSASSRRPSGMETDGHRA
WATPRIACRTRSSSCESSGRRSPVEPGISSAGRPVSIPTDIALLVDFPDELFFKSNRKRS
TIAMSQITATFMALALCFAPAVGAAATLSARRPLRGKDTLVSAQGKFELGLFTPAGSSGD
RFYLGIWYKNIPDQTIIWVGNRVSPLSSLAFAELRVSAEDGNLELVGPTGASAAPVVVWS
SNLPSPLSPGSNNTAEIRNNGNLVLVDGGNSSNVLWQSFDHPTDTQVPEAWVGENKLTGE
YQVLTSWRNAQDPAPGMFSDTVDPNGTSEIFFMWNRSRVYMRTGVWNGRVFARMPEATKN
TIYNTTYVETPAYRRVINELYDNATITRIVHDLTGQSKMYIWMPTSQNWQILWTGPMLQC
AVYALCGAFGVCDQGGKLPCHCPPGFAPVSEADWMLSDWSSGCRRRSPLTCAHNGSTTDG
FLTLPAVKLPDDSLAVGAAQSKVECESACRKSCSCQAYTFSNGECTVWHGELRNLQQLYM
DSDNPGSDLHLRLSERGLQDLRSVDKKKMGRKLWLVLGIILAGVAAVGALVILAWRIVLA
RRRRLVSMANENVFSLAVYSYGDLRAATKNFSERLGRGSFGSVYRGVLKQHKGDNSIRVQ
VAVKKLESFGRQGDKQFRMEVSTLGCIQHVNLVRLLGFYSSGDEKMLVYEYMPRGSLDGL
LFRDDTCLSWCDRYCIMLGVARGLAYLHHGCRECIIHCDVKPENILLDEDMSPKIADFGM
AKLMGRDFSRALTTMRGTVGYLAPEWISGQPISIKADVYSFGMVLFELISGRRNSNGYSE
VEVAGTGGSESLTFFPVWAAGKVLEGEVGAVADPRLRGEVMSEELERACRVACWCIQDEE
EQRPTMAQVVQALE
Download sequence
Identical sequences T1NVC5
TRIUR3_34810-P1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]