SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fracy1|241316|fgenesh2_pg.8_#_618 from Fragilariopsis cylindrus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fracy1|241316|fgenesh2_pg.8_#_618
Domain Number 1 Region: 47-169
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.87e-16
Family Family 6 carbohydrate binding module, CBM6 0.022
Further Details:      
 
Domain Number 2 Region: 291-399
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000000288
Family alpha-D-mannose-specific plant lectins 0.00077
Further Details:      
 
Domain Number 3 Region: 173-246
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000772
Family alpha-D-mannose-specific plant lectins 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Fracy1|241316|fgenesh2_pg.8_#_618
Sequence length 683
Sequence
MTIGRRQYPLLLRTSLICFVQLLALLSSYSFRQAHSIDLEIWKHKFEGDDADIYSGGSER
SSNNPKHKGYTGNGYADFGGKGSFVQWEIETTLNKAEYDILIRYSSPNQRSCYLYVDQIK
RGDYSIDPTDSWNDWRSESLTVSLKKGKHQIKIVVVGDGGPNIDSMIITGQASMDSELVV
MDNNSNSIKWSNGVLGGQASYMQGDGNLVVRNDDSKAIWNTESSGNDGAHLTIDDSGIAS
IVLTNNNNNDNNSNSYTKIWTTTATTRNDNDNDNDGRYDLPTFNSGLNPNFRSFAEEVVL
KSRDTLSRGEFISSPSNKYSIGLDNFGDLHLQDSDRKTVWKANVEGCDSATMQPDGNLVL
RDGNNKLIWTTHTSKNPGAHLVVDDGGRLSVLMGQTAIWMQGVPRGAYTGPSSRSLQFPL
RGMFYYPWYPETWSVNSKPVKFVPDLGKYSSGDGSIVEEHIDAMEYAYTDISIASWWGPG
TSKELSRMTLLMDKTIELNSSIKWTVYYEDEMFRNPSIDTIRSDLDYLKKWFVWHPAWAN
VDDKPVIFVYNEAGCSVNERWMQAAKNDWYVVLKVFPGHTDCEFQPDSWHQYGPSTEYIH
IKDVSTGISPGFWRADMDEPKLPRVSRDKFCENTKKMVEAGEDWQLITTFNEAGEGTLVE
ASSDNWGSDTKYGYYLDCLNEHH
Download sequence
Identical sequences A0A1E7F9A2
jgi|Fracy1|241316|fgenesh2_pg.8_#_618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]