SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fracy1|252875|fgenesh2_pg.44_#_57 from Fragilariopsis cylindrus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fracy1|252875|fgenesh2_pg.44_#_57
Domain Number 1 Region: 111-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000000000017
Family alpha-D-mannose-specific plant lectins 0.00077
Further Details:      
 
Domain Number 2 Region: 4-51
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000372
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Fracy1|252875|fgenesh2_pg.44_#_57
Sequence length 503
Sequence
MDNNSNSIKWSNGVLGGQASYMQGDGNLVVRNDDSKAIWNTESSGNDGAHLTIDDSGIAS
IVLTNNNNNDNNSNSYTKIWTTTATTRNDNDNDNDGRYDLPTFNSGLNPNFRSFAEEVVL
KSRDTLSRGEFISSPSNKYSIGLDNFGDLHLQDSDRKTVWKANVEGCDSATMQPDGNLVL
RDGNNKLIWTTHTSKNPGAHLVVDDGGRLSVLMGQTAIWMQGVPRGAYTGPSSRSLQFPL
RGMFYYPWYPETWSVNSKPVKFVPDLGKYSSGDGSIVEEHIDAMEYAYTDISIASWWGPG
TSKELSRMTLLMDKTIELNSSIKWTVYYEDEMFRNPSIDTIRSDLDYLKKWFVWHPAWAN
VDDKPVIFVYNEAGCSVNERWMQAAKNDWYVVLKVFPGHTDCEFQPDSWHQYGPSTEYIH
IKDVSTGISPGFWRADMDEPKLPRVSRDKFCENTKKMVEAGEDWQLITTFNEAGEGTLVE
ASSDNWGSDTKYGYYLDCLNEHH
Download sequence
Identical sequences jgi|Fracy1|252875|fgenesh2_pg.44_#_57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]