SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fracy1|253914|fgenesh2_pg.51_#_47 from Fragilariopsis cylindrus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fracy1|253914|fgenesh2_pg.51_#_47
Domain Number 1 Region: 163-263
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000157
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fracy1|253914|fgenesh2_pg.51_#_47
Sequence length 580
Sequence
MIDEDGDGDHDVEKNGVKVNKKGGDDKKQQSISSLWWKTMSEKKLFGISYRLILLICINL
IALIVVICLAARFKGINKNSNLANTGVDGAAAAGLASDGNINNNGIFDTIDNTTTATTTI
DNNNGDEEASSNGSNDNKENENDSELLLLCNEDGVTVDDDGVILSTNQAIESGEYYCSQS
KMYMIGMLDGDLSIINVNTNETVWSAGVADGIRTILRADGSLIIVDDNRLIIWKTESIPT
NNNGDSAFFNFNLDRQLVFWNNNEGIIAIQQVPATTSDNEKSKTPSTYWMDGSPNTSNNN
NNENLEFPVRGTFYFPTFDSTAESWENLNGRLPMHEPALGWYSSSDPMVAKAHVEAMEYG
KINLGIASWEGPDTNFDRSRMTMLLDETTEQNTEYLKWSICHESERRGRPDAGEIRTDLE
YLQKWFAWKESWAHIDGKPVIFVNNDDGCDVTERWNDASNDWYVVLRIFDGYDDCEYQPD
SWHDQSVNDGNDGIDIKEGLYYNIAPGEWLSGRRQPVLERLSQGEWCEHVQGMIDSNEQW
QIIDSFNEAAQGTSIEPSDDWRSDSGYGYYLDCLNDESMY
Download sequence
Identical sequences jgi|Fracy1|253914|fgenesh2_pg.51_#_47

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]