SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fracy1|186798|e_gw1.7.862.1 from Fragilariopsis cylindrus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fracy1|186798|e_gw1.7.862.1
Domain Number 1 Region: 125-425
Classification Level Classification E-value
Superfamily L domain-like 1.36e-23
Family Internalin LRR domain 0.031
Further Details:      
 
Domain Number 2 Region: 24-136
Classification Level Classification E-value
Superfamily Cap-Gly domain 0.0000000000000209
Family Cap-Gly domain 0.0021
Further Details:      
 
Domain Number 3 Region: 479-563
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000728
Family Ubiquitin-related 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Fracy1|186798|e_gw1.7.862.1
Sequence length 602
Sequence
MTSEKVNESNTSGESKSSFPKLYTRIRDTDGFVGTVVYTGSVASSKNPTEVYAGIVWDDH
SRGKHDGSVICRKTNQIVRHFACGPTQGSFLRLRKLDLGVTLTTTLLRDKYVKMNAPIIA
PNNLLPHSAKTSSGREKSIEFLGELQIRKHQQLENIVKISLRREGISKVSDDDDDMAEFQ
HIKEIDLAGNLFCDWEQVFKIIHKFSCLEIFSLAHNYIRDIDEGIVHLQFDKMKILNLNN
CSIQSFGTVSRIAEMMPNLESLCVANSDISDIEKYEINNGFQKLRQLDCSRCGLDRWQNQ
VSKFATLPLLESLSIDENPILCIPLNAGMRLSFPRLLSLQISHTALSTWLDLEGINSFVS
LKGLRFNSIPLTENLGQGEVRSISIARFPHIDYLNASRISQKERNEAERRYVTLISYSLK
KCNTLVEQNENGNDLGGECSNRMKILHDNPRYLELAEKHKNLIIFSNNGMDRNENLATSI
YNITIKSMAASSCTMDPIVRRLPGTLNVERMKALCSRIYDIDYDLICLRFITDKEDGLPV
EMDDDCKTLDYYGLCDGAEILVDEIDFHARALDTKNNDKELEKRMMEMDRNISAMQNVRV
RR
Download sequence
Identical sequences A0A1E7FAE4
jgi|Fracy1|186798|e_gw1.7.862.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]