SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fracy1|190809|e_gw1.11.74.1 from Fragilariopsis cylindrus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fracy1|190809|e_gw1.11.74.1
Domain Number 1 Region: 105-319,380-421
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.14e-42
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0000895
Further Details:      
 
Domain Number 2 Region: 3-131
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.8e-26
Family Tyrosyl-DNA phosphodiesterase TDP1 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Fracy1|190809|e_gw1.11.74.1
Sequence length 422
Sequence
MDYGCHHTKMMLVGYSSGRMRLNIHTSNLDYEDIHHKCQAAFIQDFMPKSEDQLNSFVTS
NFEETLITYLESYSFLTKLVWKNNTSASTLVSYLQTYDYSTAVGVLIPSIPGYHKFSGNS
NREIYGYLKVKQAIRDNCDDNSNDLCSSPIVCQFSSMGSLSVPYLDKVATAWNAAGELSP
SSSSSKSSNIKKGLMSSKLLRIVWPTNEEICNSVEGKAGGGSVPGRSKNLNKDFIQPKLY
RWKSTSVSGDPLDKGMHIPHIKTYYQIDNEENESMRWFVVSSHNLSKAAWGEIQNRYDQG
EVITIQSWELGVFVSPSTLGVDVMGPLLSSANSNGHSLGGNSSSSQDPLDPKQLREQRLA
RFGGGGRTDRRIEQEPQPKVASSSSPTEMDPNQKNNQRSIIPIPYKFLPDKYESSDKAWV
VD
Download sequence
Identical sequences A0A1E7F4I0
jgi|Fracy1|190809|e_gw1.11.74.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]