SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fracy1|224596|fgenesh2_pm.3_#_214 from Fragilariopsis cylindrus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fracy1|224596|fgenesh2_pm.3_#_214
Domain Number 1 Region: 428-623
Classification Level Classification E-value
Superfamily Sec7 domain 1.1e-67
Family Sec7 domain 0.00000644
Further Details:      
 
Domain Number 2 Region: 166-386,999-1043,1071-1091,1154-1195,1222-1298,1347-1423
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000000222
Family PBS lyase HEAT-like repeat 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Fracy1|224596|fgenesh2_pm.3_#_214
Sequence length 1637
Sequence
MLRGSHLLQTIRVLYHAFLSTSTEANKTTARASLQQLVTSVFIRMIVSSSSIAERNHGMD
DGIDNNREIDNNQDGATTPTNATDPEGGPVFPSENHRDAFLVLRSLCKLSMRVQPSGERH
SHVGLQTSGSNAMWDSSKDPTGRSPMKSTKAGQDIYGGEQNKEGLQHIYTHAIHPALESK
ILALDLLLYLLKRTDMSGSFLQGCGPQFHYAIRNYLCVSLLKNCTSDDTRVVNLSLRVFV
PIFQHFRSILKTEIEAFVTNVFFVILDSKNSPIEHKSLVVTLFDEICSDPTTLAEIFLNY
DCDLSAVDLFHRIINTLSKVARTTDSINPDSNSTMSLISGSGGARMERIRTEHRELRLNA
MRALRQVLASLNASIVEPMQICTSSEEKGNNKHDIERTETLSKPLKINENGHNDGDGKKS
LVQIYDSKKKRREEDSEIVLRFNQKPKAGISYAVKCGHIDGSDPTDVARFLLKNKDRFEK
AQIGEYLGREPEYEKGFILKVLHEYVNLMDFDGLAFDTAIRYYLSGFRLPGEAQKIDRIL
EKFAERYSEQNPDAFPSADVAFILSFSIIMLNTDLHNPSIKEERKMTKEGFIRNNRGISD
GQDLPEEMLLDIFDRIKENQISLKEDDDARERVNDGTSSKANNALSPAVFFTNHYDEMQK
TKESNFVKERDQIVRTTESLLKRRRHATLDSGKSGQRKSRSSSNANKSSHLRYVRTEDSG
LRDEYVAPMFEVTWGPALAAFSTAMESANGTIGSLLAIATDEELEAAAINAAETIEVCLT
GFRFAICTAGLVGNDVARDSYMFALSRFSQLGTGVLLEPRHVRCIQTMLVLARSDGELLG
SSWEHIFRALSEINRFHQLFQLMARNDRAIAAERRRVEKEKSDTIDDESVDSDDFSSDTD
SYDGSSLFNDSDDFNFNDEMDTKEIDEANARTVYQAVAEDIVEATYERSSSMSTEAVKEF
ILQLCRVSRMEISHYGFHHQQTNIYNLQKLVEVTHYNMDSRPRMVFADIWTTVSAHLTST
ALHSNPAVAMYAVDAFRQLYTQYLQREELGVFEFQRRFLKPLDTVMARSEISTTKELLLR
CVERIILMFGSPREGKRGGMLRSGWRPVLKVLGLAGRDSDEEIAKLGCGMLNAQIQECLD
QCTEDGEFEAGQGNLLVERFVDLVDAVLIYVGGPHEEMSLKSIDDLMKLCDFLADESTAS
PLLKKRRSVASCNGEDSADVNEVAANEELELWWPILLGLSRSIGDSRKKVRRKSLESLMK
IVSSHFFPSDERQESLDDEAKSKYIQTLQLVFRGIFSSVLEFGDGESTDAKTPLLPSDFE
RFLAVKKPGDPQKSDEATQEPSWIDTTFDPFIDDCIHICLRSMKLFGDDTLIEEILAMLN
SCLISDSGALAVKGLRRLELFVSSDLRTSSIKDDTWATISHMLRRCLCVRGLPRRSHSIN
LNGNSIAASSASEKTVTDESKSKDKNDDEETPNLELEEKEMIREFVDEDSMFFDRRYIGS
NTISVIGKFLEAEHFTKSLSLRWRIFLVSGVGRGIIDWEIAYGISARNSGNIDNPRRPGS
PSYLETAYYGRKWMNRFLLQMATMKEIAGTAAEGSKQAALQEVVKEQTQALVSAFLEKEA
VVAAKNRKLSRNFGNGP
Download sequence
Identical sequences A0A1E7FPB8
jgi|Fracy1|224596|fgenesh2_pm.3_#_214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]