SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Fracy1|251818|fgenesh2_pg.38_#_29 from Fragilariopsis cylindrus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Fracy1|251818|fgenesh2_pg.38_#_29
Domain Number 1 Region: 210-272
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000406
Family alpha-D-mannose-specific plant lectins 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Fracy1|251818|fgenesh2_pg.38_#_29
Sequence length 611
Sequence
MKMMRTNKVANRSKKKRSASNNNNNNSSASSSSSIVTAGPDSVQYEFEWEAIEVGLTRQK
EEPVTKSSGDVLLRKVLSICIVILLLLLIPVVILLLMRRPPDNNMWTPPDYDFDFAPRTL
VLNSGESIIASDLIAPLNFVSPSGLYQLSLNQNGDLTIRSRKKINLNTTTSDTDTDTNTA
GRRKLLSTIDTDTDTVTHNWSDILWQKDGFPDNVYTKRNIKLSMQIDGNFVLRDTSAGEG
ITVLWKSLTRQNPNAYFVFDDSGQIKVIDATSGYPLYLDGIPTKLSVQSKTNDDDNDDDK
STTKNTDIATTTATNIAGGGNLGPYPVRGIFYYPWFPTTWRSSDDDNNHLAHYIPKLGQY
DSSHYDTIVNHVEQLEYGHIQLGISSWWGPDTKSDKARLLLMMDASWQKTDGRLKWCIYF
EPQQGDDTVEGIRSKLKYLKEWFVDHPSYGRTREENKPVLFVYNKNSKDGTDCQKTSKLW
SDANAPNNEWHIVLKLFSGWRDCEYQPDSWHQYGPSTQFHYQDTDNAGFVNISPGFFHAK
EEVPRLERLTSTEWTESVQKMSSLRDDDSSNIKWHLITSFNEAVEGTIIEATDEWDTNSG
MGYFLDALHNN
Download sequence
Identical sequences jgi|Fracy1|251818|fgenesh2_pg.38_#_29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]