SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|106797|estExt_Genewise1Plus.C_110021 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|106797|estExt_Genewise1Plus.C_110021
Domain Number 1 Region: 10-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.06e-23
Family APG12-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|106797|estExt_Genewise1Plus.C_110021
Sequence length 96
Sequence
MCLGLNRSSAVTIRLQPIGSAPHLTQRIFKLSTNQNFATIVRFLRKRLGVKEHESVFCYV
GSVFSPGLDEGVGNLWSCFKQGEELVVGYALSPAFG
Download sequence
Identical sequences jgi|CocheC5_1|106797|estExt_Genewise1Plus.C_110021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]