SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|110283|estExt_Genewise1Plus.C_160557 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|110283|estExt_Genewise1Plus.C_160557
Domain Number 1 Region: 416-577
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.53e-24
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 306-406
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000294
Family Rhamnogalacturonase B, RhgB, middle domain 0.026
Further Details:      
 
Domain Number 3 Region: 115-302
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000129
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|110283|estExt_Genewise1Plus.C_160557
Sequence length 579
Sequence
MKSLLPLLVYGGAGVVASASAYSHHDSSPQQPKSFFRQIGNATWILGNELWNVTQNAQYA
TKLMFKGKDRVGEAVGHYVSYNGAASDLRWTTASIASSGPNWLDIRFRAVEGDFHWVLHD
DLAGAYQYFINRALPTLGEFRTLWRLSNASFPNASTNVKSGPLPPFSAYQNPTKVQDETW
QKSDGTFLTKYDWAAFLREQTAYGVWGDEVGSWYLHAGKDYLNGDQLKQELMLHRESQTG
DTVQLNMLHGTHYQASSRDSFAAGNANARVWGPWLWYLNGGSRQDAVARWEKEEKEWPYA
WFENTAYQSRGAVQGKLLLSDGRPAAGAAVFLGDNRNETVSTLDQGQNYYYTAYADDTGS
FCIRDVRSGTYALYAWGNGRPIADVITNFTHNDVEIVKGKTTTLPLLTWPVTNRTKRIFQ
IGDFDRKTDGFYLADPAIPVQHARIDKCPANLTYTVGTSTPSRDWCFGQSKLGTWSVSFP
VPSANSTAARLVVSLAGFSQGSSADILLNEAKIGNITSASLANSQDTYRGATRAGEWRRL
EFGVPRGLFKEGQNRLDVRVTKSTQWRGWLWDSLVLEAV
Download sequence
Identical sequences M2TIQ2 N4WXS7
jgi|CocheC5_1|110283|estExt_Genewise1Plus.C_160557 XP_014078139.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]