SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|111630|estExt_Genewise1Plus.C_190388 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|111630|estExt_Genewise1Plus.C_190388
Domain Number 1 Region: 45-130
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000178
Family Ubiquitin-related 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|111630|estExt_Genewise1Plus.C_190388
Sequence length 242
Sequence
MSEFAFCKSFLSALDARPIKLSSDHIADARQYPAQGAYTLPRLPHPPHPQRPNPKSTDSA
DASTSASTITVTLKPMKPSTPTIPLSAIDPSKTSVYDLKQQYATQASLSAAKIKILYKKK
PVTDSKTLIEVIGTDAGAEVEFGVMVMAGAAAASGSPAAGGTPVTSPPAVAPPTESEKGL
ASAGESSAGASSAVAGAVSGKDIVATDEFWGDLKTFILQRTKDAEEGERLVGVFKAAWEQ
NK
Download sequence
Identical sequences M2UVQ1 N4WQ65
jgi|CocheC5_1|111630|estExt_Genewise1Plus.C_190388 XP_014076513.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]