SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|116821|estExt_fgenesh1_pm.C_50151 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|CocheC5_1|116821|estExt_fgenesh1_pm.C_50151
Domain Number - Region: 1-52
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00355
Family Ubiquitin-related 0.014
Further Details:      
 
Domain Number - Region: 832-886
Classification Level Classification E-value
Superfamily XseB-like 0.0366
Family XseB-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|116821|estExt_fgenesh1_pm.C_50151
Sequence length 1385
Sequence
MSLQIAVAHTGQRLDADPVAFTSVDALKYWISRTTEIPPEQQVLLTTQGKHKEIFVFSRE
ISNNPQAAISSTPLPDPFAPDDAPNHLANNTDLGAWQALFQARRNWAFALLEKSHSMSRI
ASKHFAEQATIERATQVAVGNHDAHIKGLEQKYKAAKEWYDGEMRSAKNVPSNVIVRETL
QDFLDVEAVKMATATSQRVREAFGKRMDKTNMQLEKIAADYNDLLRAVGQSQSRSVVDDT
EEPVRLYNEIDAVAKKVESDLEHVMGLEASSKSVAQVSKMALLHTRNFLPAIQEYSVEMS
DLVRRAVEQKNAAIRNSVESMQGIANIESFIASMGADLEQISIPQEGVAAFELISLVGRL
PYVYGTLLVEAVRRREWMERMERDTSSLAEEMATFQEEEERRRKRWLKPIADVVNLEAVQ
GGTLGFEMNVQPEKTVWPTVTREELRDYLKDLQRLDGQQSEAEAFAQAIKDLDRPTKQQI
KRAKNFKMGSVHEPAFGRGSHLMMRGDDELRVLKEGNAKLEEELRGYKSRVRRLEDLVHR
QNTVSRLSIGGAPPSFSIPDAAEPSTPTARVASPRPMEENSRRSSISSRRLSANTGQEDK
RRILRLEQELAAEKEARVKLENEAQSRRDEDADQQRRFEEAMSTTNNIMENMRAQQKEFA
EERKSLEDEIRVYKARIEEAEDELDRLLGSRDNERIGIDTRVQELVAELEQTRKEAAEQK
TRTDEQTEALQAEIIKLKATRAQERDSLATVFNHLSPGTSVPDDHSALIAQLEDVAVRSL
NYQKELQQAVAVAKSDNDNAHARIEEQENNFNAKVAEHEKAIALVREDLDAEKAKAASIT
AQLEEEKSHLHDLRSKFAEGETGSEALRKRVEEEEAKVGRLQTELAEKNSHANSLDVELM
RAEKRLRKLEEVDSSRTHQRMTRAKDLSQRLYTQHERLVRLLEALGFVITHENGEMVLQR
ASKLGNSTVMADTSAGISRSTTAPSPTPLKRFLEDVGDLHFLQWTEAMSPEEEDQRYQEL
ISKLDLFNIETFSDAVAKRMRDMEHTARKWQKEARAYRDKAHRFQADSHDKIAYRSFKEG
DLALFLPTRNNAHRPWAAFNVGAPHYFLREQDTHRLGGKEWLVARISKVEERVVDLSKTL
DGPPRASLDDRSVASSNAVSFEDDNPFELSDGLRWYLLEATEEKAMAPGTPGIKGAVTVK
SSLETGQGEMQKSKKKSLMDPATQLGKSLDSRRSSGTSKKSAPLAGKNNSAEALSPGERA
NSTPNSATATRGGSPAGAHGPSHLRETETNGTEPDKTAYDGNGTNVSVSQYQSPRKSSIP
TLLSSLRSMNNSPVANRAPASPTTDTRTASPSTSTPRREPHARKSSIWDSFFQYDIEYQG
KTSKK
Download sequence
Identical sequences jgi|CocheC5_1|116821|estExt_fgenesh1_pm.C_50151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]