SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|117986|estExt_fgenesh1_pm.C_110067 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|117986|estExt_fgenesh1_pm.C_110067
Domain Number 1 Region: 152-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.86e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 2 Region: 228-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.08e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 3 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.28e-34
Family Ubiquitin-related 0.000028
Further Details:      
 
Domain Number 4 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.3e-33
Family Ubiquitin-related 0.000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|117986|estExt_fgenesh1_pm.C_110067
Sequence length 305
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR
LRGGQ
Download sequence
Identical sequences A0A059PZS1 A0A1D6BFE9 A0A287XMB8 A0A2I0B7G6 C5XG97 G3CFQ4 I1HXI1 K3XYG0 M2RNB7 M2UIE8 M7ZGS1 N4XL72 P69309 Q41411 Q8H290 W7EM55
TRIUR3_28577-P1 EG:BRADI1G32860.1 EG:BRADI3G03957.1 EG:BRADI3G04730.1 jgi|Cocvi1|96666|e_gw1.33.221.1 XP_002456845.1.57931 XP_007695807.1.66866 XP_009412666.1.42102 XP_014081015.1.79200 XP_014557629.1.39273 XP_020099924.1.18548 XP_020195533.1.58150 XP_021288966.1.83089 XP_021304194.1.57931 15368.BRADI1G32860.1 15368.BRADI3G04730.3 4558.Sb04g004280.1 LOC_Os02g06640.4|PACid:21922575 LOC_Os06g46770.6|PACid:21932935 jgi|CocheC5_1|117986|estExt_fgenesh1_pm.C_110067 LOC_Os02g06640.4|13102.m00739|protein LOC_Os06g46770.6|13106.m10575|protein CGD0021657 jgi|Sorbi1|5037609|Sb04g004280 jgi|Sorbi1|5054263|Sb03g043940 Si006968m|PACid:19705778 Si006969m|PACid:19703932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]