SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|118089|estExt_fgenesh1_pm.C_120019 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|118089|estExt_fgenesh1_pm.C_120019
Domain Number 1 Region: 5-64
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000967
Family Ubiquitin-related 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|118089|estExt_fgenesh1_pm.C_120019
Sequence length 342
Sequence
MAETDNSPTPPTSGDTIQITLTHHGKSIAFSFAKDATIFDLSERVATELSIPPSNQKFLV
GGKIGLQKPPFKDAALPLTELTSKKITLMGSTKEEVSSLNSTISAASAPRRPGPIKAATP
ARNRDYKKIQEEAQYTFHTLRPLPYLPNPERSLRFLERLRDDAGIKAAMRTHKFSVPLLT
EMDPAMHTTQESRTLGLNRNKGEVIELRLRTDAYDGYRDYKTIRNTLCHELAHNVWGPHD
RNFWNLCKQIEREVARDDWKSGGRSVGNEEFYEPTGEEEVHDHGGWTGGEFTLGAVSGGG
GTVVSNTSGGGMSRREILARAAEERMKRTKKAEEETDGAGSM
Download sequence
Identical sequences M2SPZ7 N4XDG2
XP_014080457.1.79200 jgi|CocheC5_1|118089|estExt_fgenesh1_pm.C_120019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]