SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|21011|fgenesh1_pg.C_scaffold_12000198 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|21011|fgenesh1_pg.C_scaffold_12000198
Domain Number 1 Region: 8-94
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.81e-17
Family Ubiquitin-related 0.0024
Further Details:      
 
Weak hits

Sequence:  jgi|CocheC5_1|21011|fgenesh1_pg.C_scaffold_12000198
Domain Number - Region: 97-139
Classification Level Classification E-value
Superfamily Cap-Gly domain 0.000942
Family Cap-Gly domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|21011|fgenesh1_pg.C_scaffold_12000198
Sequence length 177
Sequence
MSLQSAADVPLLISSPNSSSERRISPAWTIAYLKTRLEPITGIPAACQQLSLRLASQDPV
ALVAADEDHTQLAAFPLQPYAEISVVDTRPPAARTDFNDLSAVEKYEMPAAEYEHRTDSV
LAWKKAQKLGRFDPNAPSIEQQKIRASEREVEERAAAAHVRLQGLATHIMSAGFIQS
Download sequence
Identical sequences jgi|CocheC5_1|21011|fgenesh1_pg.C_scaffold_12000198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]