SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|21679|fgenesh1_pg.C_scaffold_15000067 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|21679|fgenesh1_pg.C_scaffold_15000067
Domain Number 1 Region: 21-277
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.98e-48
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.0000912
Further Details:      
 
Domain Number 2 Region: 369-545
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-35
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.0000357
Further Details:      
 
Domain Number 3 Region: 283-361
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000133
Family Rhamnogalacturonase B, RhgB, middle domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|21679|fgenesh1_pg.C_scaffold_15000067
Sequence length 547
Sequence
MRCLAAFTALLLAPTAVFAAWGYTDDGKNYVIDTNANLVVKVSKSNADLTSIKYRGVEYN
GQNGKNSHVESGLAPGTVTIKQYTSPANIIKVTMKVGTLTHTLVFRYGNPNVYIFMNKRD
TSITVSRYIVRIPANIFTNNVNEDTDWVPNGAPAIESGDINGINGQTWSKHYSGKKYGRT
IDYDYVGYTNNNVGMYLIRSNHEKASGGPFFRSLIRRGGDGGPDLYDIYQYNMGHTDPMR
LGLQGPSVLHFTDNGAAPNHNLFSRNANWDWFDSLEIEDWVPASRRGAVAGVGLANMKSG
FQYVVGLKNDQAQYWTIATGAWRIGNALPGTYTLTVYKGELEVHTSTVSIAAGSTATRNT
ITLVDPNDTPAIWRIGDWDGTPRGFLNFQDTPMKPTYMHPSDSRLANWKVGNFIIGTTPI
SGFPAYIWKDINNDYLVYFRLTDAQLARGAKIRVGVTQGQAGGRPTVAVNAWAAKLPADK
GQGDTRSLTVGTYRGNNYVYEFDVPASAWVASAREYQILKITVISGKTAAGYLSPAVSFD
AVELIGL
Download sequence
Identical sequences M2UE17 N4XI27
jgi|CocheC5_1|21679|fgenesh1_pg.C_scaffold_15000067 XP_014080095.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]