SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|29043|estExt_fgenesh1_pg.C_60051 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|CocheC5_1|29043|estExt_fgenesh1_pg.C_60051
Domain Number - Region: 136-207
Classification Level Classification E-value
Superfamily PH domain-like 0.000348
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Domain Number - Region: 774-843
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00787
Family Ubiquitin-related 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|29043|estExt_fgenesh1_pg.C_60051
Sequence length 860
Sequence
MSAPVEAPKTVDQPEVAATTEAAPAPVLAPDNTVAPVEEPKTEEAPKDEPVAAAEETKAD
EAVKEEPKEDKVVEPIYSGALGYKAPGLKNAFRFAKKFFWFGEEPVAAESLGEYLRGEKP
EVAHPTVAWSSQTGKGLLFFVKHADKKDQPAGVLNLAYATDLAKDGALAFAFKLSGHKHA
FEASTTAERDGWFVAVEKAITEAKASKDTIESSEGYKEAKEKIGKPTALAGATAAPKKSM
DVAPKLAEGEASEPAAAPARTGSSSSSSSDDAKAKKAKSKSRSVSRGKRTSLLGGLLGKK
DKEPKTESEAVKEEPESKAEEPAATAPHLDEIPTTAPVDANDVVKPTETTAEPAAPVAAV
PTEEAPKAEEPAATAAPEKPKPTKRASIFGTFVEKLKSPTTEKREAEAGLAATPVKENET
VAEPAKPVEETAPVAAPSANEAAAAELNKDEAKPVVATSTPSKEKEHFSFGKLFGNKDRA
KSPAAQEKLPEPKADAAPQIEDASAPAPTEAEATPATTEAKPETTEEPKQDKRKSFFGNL
GRSLSKATGNKSQANKEKKEAAAAAPAPVVEEETAPAAVPVAEEKKEEEAAAPVAPVAEV
PAENSVGDASKSANPTVATTADEMVVMGRYMPAGCAVTDDCPFQRSRLPNTLAAAAATTK
PSSRVKPLTDPTALKWTRARLEKERQDWWDTQVTGSPEIWGAIRLAAQHLQAGELQEAQT
MLDVTGCTCPTGLVWRGVFDATGVQYKVPEWVVVEPEGIVEEDEAEEGAGVEVEEEDESD
EEVDVRVRMSHDSKDVIVRVHKKESVARVVEKVKDAAKLDPFVRIRLAYGGRVYHEHESL
ESHPHWNFDNQFVVSSFVFL
Download sequence
Identical sequences jgi|CocheC5_1|29043|estExt_fgenesh1_pg.C_60051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]