SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|29502|estExt_fgenesh1_pg.C_70194 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|29502|estExt_fgenesh1_pg.C_70194
Domain Number 1 Region: 456-564
Classification Level Classification E-value
Superfamily PH domain-like 0.0000436
Family Pleckstrin-homology domain (PH domain) 0.037
Further Details:      
 
Weak hits

Sequence:  jgi|CocheC5_1|29502|estExt_fgenesh1_pg.C_70194
Domain Number - Region: 356-424
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00011
Family Ras-binding domain, RBD 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|29502|estExt_fgenesh1_pg.C_70194
Sequence length 937
Sequence
MATDAMSSTQKVSRYRSVRRAQEQPPMQPGQFSQHDQPSQGMSTVPTMSAVPDSQPQNDA
PLSRSKSRYHRRPPTSHATSPQPPPRSNTTFDPPPPLCPQSPPYASSNDADSSPQQTSYA
ANTAQRRPRTAKPRAQASPLVYGAPRDHSLSGDDSAREILEKEKQRQRQMKERHDAEARA
RRQAQQAESDRADKLRQEAEEAARLQKLQQQQREFEEAEALRRQRIEQKAEQERGRRLQK
AEPRKTSQNKDELQRQAALARLEERSQKPPASPNAISPPRQQEVGIGMFKRRKDEALGLD
APAQLSAAPQLSLSLSHEEETIKPGGGGAVLGIDAPTSAVNAGDRRVTVVCNKKRIQLPV
TPTTTPLDLIKSASTVLADPIDVRTAVISEYFTKVSITRPLRNYEYVRDVMNSWDHDNQN
ELTIIDSDVDGINQDDLLAYKVPEARPEGMSCFIQYSSRPGKWSKRLLTLRPDGQLVMAK
NEKTKEKDLENICTLTDYDIYTVTQQKLARVKPPKKICYAVKSMQKSNIFADESQYVHFF
CTNDRNTASMFYHALQSWRSWYLKYQKGEGLKKKSPAMRNVSGTQETGQSSAHARGESVG
SHYQLGAFSSLLDMDSFNKKLDEIEVHKPGEFPDDKPLSKLDSRAMHTRKKSLRVKQPPP
ATLIKGAVNKPNPSQPTSRQTSGRRSFEGKEEEEAFTSSGLLGRGYSERQAAAQAREQQQ
ATAFTEGPSLLNVGRLGQADSSIKRSTSTRSNHNRRISSDLQRSASKRIPGMPEPLIDLT
PQYRPPPQHLNKGKGYNPGAGAGPLVESATSIEEAIKVPSSTDWRAGRPGTSRAHGTYGA
GGHERTRSLKGRGEPLAAYTHNNHGAAPEDASKAFTGGGLLSRAGYSQGPDVIGRGVMDG
SRARGPMVNLNLNSEFAQGSLLGGMPVAAPVIDRSGK
Download sequence
Identical sequences M2T4D9 N4XHV0
jgi|CocheC5_1|29502|estExt_fgenesh1_pg.C_70194 XP_014082037.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]