SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|29699|estExt_fgenesh1_pg.C_80024 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|29699|estExt_fgenesh1_pg.C_80024
Domain Number 1 Region: 615-970
Classification Level Classification E-value
Superfamily L domain-like 4.25e-61
Family Internalin LRR domain 0.021
Further Details:      
 
Domain Number 2 Region: 1613-1783,1819-1850
Classification Level Classification E-value
Superfamily Nucleotide cyclase 1.57e-56
Family Adenylyl and guanylyl cyclase catalytic domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1269-1563
Classification Level Classification E-value
Superfamily PP2C-like 7.59e-44
Family PP2C-like 0.00047
Further Details:      
 
Domain Number 4 Region: 1081-1254
Classification Level Classification E-value
Superfamily L domain-like 1.25e-23
Family Ngr ectodomain-like 0.0072
Further Details:      
 
Domain Number 5 Region: 503-570
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000362
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|29699|estExt_fgenesh1_pg.C_80024
Sequence length 2001
Sequence
MTRNETVGRHASVESSWSSRSGDTIRPYGRAGSLRGTPVTVKTDKTLNSNAEKESEISPG
TVPPAPPPKDPSHRPWKPSHREGAAMSPFGEHRKQLAVLETSGGRVPAISRNPPTATSAT
SQATPWSSASNGNSMANGVWSSFFNDSNEDVSQSSPGFRPGTSSREDSMGFPFKDDRRPS
VASATTVSSTGSKSSIGRGFHKRLQNVFGEDFPADGRQNSDTSLNMPYAPDTQSIRGQRN
RGNSLNNTIGSGHHSRPTSPTSSRPRTPQASSEVTPWEFQDPKRSPSASKPAHGFFARLR
GKDKSDRNVQSESLKNLTSSGTASATSLNPSIAPARLTRPELPPQANMAKRPATSGVADD
KSLKEQRGRAPHHRLPTFRKEKRAPMMEPTGRDPNENIASTAGNDAVFFLDRNLDDMEGI
VNLQQQPPMTPPVGELQKQPTLREDIAIPPEDDGTAAWDAPDSWAVKRTKDEVEKPADVE
DIPTPSKEEHDNKTYCLRIFRVDSTFATLSATLNTTVQEIIQILGKKTVLQDELDNYHIV
MRKHDTSRQLDSNERPLLIQKRLLELAGYTDKDRLEDVGREDNSYLCRFTFLPAKMSGYS
SLERDPGFSKMQKFTHVDLQGRNLITIPITLYQKATEIISLNLSRNLSLDVPRDFILACT
NLREIKYTSNDARRLPPSLSLASRLTMLDISNNRLQSLDRAELYKLQSLQGLRLSNNWLT
RLPPYFGQYRALRSLNLSSNSLNEFPDFLCEVRTLVDLDISFNSISSLPKIGQLTCLERL
WATNNKLTGSFPPGLSNLVNLREIDLRFNALDSMDVMSQLPRLEYLMIGHNSISAFEGYF
PKIRVLHMNHNPVTRFGLTQPTPSLSVLNLASAKLAQLPDDLFSKLTGLTKLILDKNHFT
SISKNIGMLYRLEHLSIARNSLDVLPAEIGRLVELRYLDVRENNLSVLPQELWYARRLET
LNVSSNVLDAFPKPGAAPPQVTNGEQAQTDGPTNAHALKATPSYEELGKLEDFQNRRPSQ
ASGGLTVASSPAPSNRTGSMTSYNSSSTTRKPSTASRAPTEGTVTPMSRKDSSLSSRMVT
TFAGSLRHVFLADNRLNDDVFDELCLLPELRIVNLGYNLIYDIPPRTIRRWQHLAELYLS
GNDLTSLPAEDLEEVGSLKVLHINNNKFQVLPAELGKVAQLAVLDVASNSLKYNVSNWPY
DWNWNWNHKLRYLNLSGNKRLEIKPSGSYSGSGSSMREGRDLTDFSSLINLRVLGLMDVT
MMVPSVPEQSEDRRVRTAGSAVGTMAYGMADSLGRNEHISTMDMVVPRFRSHDDEQLLGM
FDAQPLAGGGAKIAKYLYDNFKNRFADELERLRPQETPSDALRRTYLGLNKELATAASQA
LDKNAFASPTQQRSSVPELSDDDLTSGSVATVLFLKEMELYISNVGDAQALLIRSEGGHK
ILTRKHDPAEPGERARIREAGGFVSRQGKLNDVLEVSRAFGYVQMSPSVIASPHILNMTL
GDTDEMVLVASRELWEYLTPDFAVDVARSERNDLMVAAQKLRDLAIAFGATNKIMVMLLG
VSDLKSKQRARYRTQSMSLIPAPGADPDWGASRRRGKKGNLVGDSKLARLDNEVDAPTGE
VSLVFTDIKNSTILWETYPIAMRSAIKMHNELMRRQLRIIGGYEVKTEGDAFMVAFRTVT
SALLWCFTIQSQLLEVQWPQEILNSVNGQEVVDADGNVIFRGLSVRMGIHWGTPVCEVDP
VTKRMDYFGPMVNRASRISSVADGGQITVSSDFIAEIQRLLETHIEGDRNNSAGSEEAYG
DDLNSQMIRSELRSLSSQGFEVKDLGERRLKGLENPEYIYLMYPHSLASRLTVQRQTDAK
PADPKAESTVGQKMAGSQLTIDTEDVWDLWNISLRLEMLCSSLESPGCSELKPPETALLE
RMKSRGGEITDRFLVNFVEHQISRIESCVNTLFLRHRMRPFGSAPLLQQACHMGDIFAEL
EAKLQRLAEFERGAIEGMAPS
Download sequence
Identical sequences jgi|CocheC5_1|29699|estExt_fgenesh1_pg.C_80024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]