SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|30372|estExt_fgenesh1_pg.C_100137 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|30372|estExt_fgenesh1_pg.C_100137
Domain Number 1 Region: 129-246
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000000000000677
Family Ubiquitin thiolesterase protein OTUB2 (Otubain-2) 0.028
Further Details:      
 
Weak hits

Sequence:  jgi|CocheC5_1|30372|estExt_fgenesh1_pg.C_100137
Domain Number - Region: 3-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00265
Family UBX domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|30372|estExt_fgenesh1_pg.C_100137
Sequence length 328
Sequence
MPIRLRLRAPNGTHTLSLDDNAAVSDLLSSISEKTELPLFELKWNHPPQPLDPSLYGMST
LLKDIDLKLNGASIIVIGKATGDPSERKAEQELQSATSQSAPLSLQRKQNSALKDTPEVP
VPDRAGTIVLRVMPDDNSCMFRALGSAVLSDSLDAMTELRSMVAQAIQRDPEQYNEAILQ
RSPDEYCKWISYSDSWGGGIELSILSQEFDIEIASVNVQDNRVDRFNEGRPRRCILVYSG
IHYDTIALVPQGVSPQDPSQDIKLFDANDDVILEAARELCRQLQKQHYYTDTQKFDIKCN
TCGWKGAGERGAIQHATETGHSDFGEAN
Download sequence
Identical sequences M2UDN9 N4XAG8
jgi|CocheC5_1|30372|estExt_fgenesh1_pg.C_100137 XP_014077450.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]