SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|31316|estExt_fgenesh1_pg.C_140096 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|31316|estExt_fgenesh1_pg.C_140096
Domain Number 1 Region: 192-319
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.26e-33
Family UAS domain 0.00021
Further Details:      
 
Domain Number 2 Region: 382-489
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000336
Family UBX domain 0.025
Further Details:      
 
Domain Number 3 Region: 3-41
Classification Level Classification E-value
Superfamily UBA-like 0.00000129
Family TAP-C domain-like 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|31316|estExt_fgenesh1_pg.C_140096
Sequence length 494
Sequence
MDEESVLNFCSITSCDPEKAAQYLRLTDGNFEQAIQLFFDAPGLDFTPSAPSQPAPAATA
QNPINIDSDDDMEFDAAPSGANPPARSQPGVEDDEAMARRLQEEMYGGGGPGGAGVDEVR
APMQRTTETLVGPGSNWGPADEEEDIDALVQEQLARRRTGRAGIFNQHTTHTNVWDTTTD
SSTRRRELATATGGSWEKARDMGKDEEKWLLVNIQDPAIFDCQRLNRDIWKNEDIKATVR
ENFIFLQYAKDDQRGQQYMNYYFHARDSSDAYPHIAIVDPRTGEQVKVWSGPPIPEAVEF
HAQLHEFLDRYSLNVNAKNPVAKRKSESKKKDVNRMTEEEMLEMALQNSLENGKGPQEDD
PDALTKSTDNIKGKGKAEEAAPEPEPEAAPSNPAFAAISAQAPHTEPTVTDPKVTTRIQF
RGPSGRPIVRRFNLADPVRRVYEWIKSDVPWEGKQGAEFDLSFMGKNLIEHLDETVEAAG
LKGASVMVEFMDSE
Download sequence
Identical sequences M2T0F6 N4XKY8
jgi|CocheC5_1|31316|estExt_fgenesh1_pg.C_140096 XP_014079736.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]