SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|31334|estExt_fgenesh1_pg.C_140116 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|31334|estExt_fgenesh1_pg.C_140116
Domain Number 1 Region: 2-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.36e-21
Family UBX domain 0.0052
Further Details:      
 
Domain Number 2 Region: 343-439
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000015
Family UBX domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|31334|estExt_fgenesh1_pg.C_140116
Sequence length 516
Sequence
MSHVVVFNSYARSFKIPTTPTKYLTEVRDEACQKFGVNKDQFTLKYNNKPISLSQQIRLA
NLPQGARLELVQASRSPTVISVALQLPASEKNRGIPEMSGASGAGRLHYEQPVITVMPGH
KEQSSFVELQQTLSQLGFDSGSALLKLSYRNSGTPLEEAMAQISQYFKPSEPSTGAEGAH
ASTTSQLASIPDPAQAAPEATETVAGETVHNDEPDPEPMDVEPKTAAQPAQEQEVSTEKY
AAESIENTSPAAALAAATSTAPSVPAPPSQPLSQTAQDTSQPAEKSRNVQIFSAPTSSTP
QAARNAFNESDYLPTIEHAKAHQNALLNKTKNTRLLSDKELEEQEKERQAKIAAAAEKGG
SLRIRMPDGALVQMSFNKNDTAAGLYDFVRDFLEKKNEPFQLKNTGPTGRLVLIPRDDKR
LVQDLRFFNNELVTFQWAENASAEARASRHVLASEWQAKAQTLKVEEPAREDPVQPQSNQ
SQGGSVAEGKRKANMSNEEKESKLKNLLGKGLFKKK
Download sequence
Identical sequences jgi|CocheC5_1|31334|estExt_fgenesh1_pg.C_140116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]