SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|82703|estExt_Genewise1.C_40322 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|82703|estExt_Genewise1.C_40322
Domain Number 1 Region: 29-284
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.42e-78
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.000000114
Further Details:      
 
Domain Number 2 Region: 376-544
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.97e-50
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.00000102
Further Details:      
 
Domain Number 3 Region: 287-369
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000000451
Family Rhamnogalacturonase B, RhgB, middle domain 0.0000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|82703|estExt_Genewise1.C_40322
Sequence length 545
Sequence
MYLRTSSSSSLLALFTAAITLPSTTLASFGVTKAKDSITVDTGSTTDPFLFTVNTLNCDI
TSLKYAGEEFQWPVKGSQIEMGLGSATVTYDTIGTQYIKVTCTTPTLTQYMVIKAGDTTI
YMATDITAEPDVGELRFIARLDSIKLPLSYPFGIVSTTANSTATVEGSDVFVVDGQTRSK
FYSSDRFIDDAVHCVYRDTNAIHACLLMDSYSYETSAGGPFHRDINTNNGGPSNSLTFYM
NSNHVQLEKYRMGMKGPYALSFSRSSIPKGGSSMDTTFFKDLSIPNYVAPSGRGTVTGKA
TGVASTSQAVVHWYNDAAQYWAYASSSSGTFTSPAMKPGNYTQVLYQGEFKVKATSVTVA
AGRTTTANIAADTEPKTSLWRIGEWDGQPKGFRNADKQLRMHPSDSRMASWGPLTYTVGS
STLDSVPMALVKDLNPLTINFTATQKNTAALTLRVGTTLAFAGCRPAVTVNTSFSAPLPA
APTKIASRGFTRGAYRGFGEVYNYAIPAGTLVEGANTIRISCMSGESGTGFLAPNVILDA
IELLE
Download sequence
Identical sequences M2SXA1 N4XTT6
jgi|CocheC5_1|82703|estExt_Genewise1.C_40322 XP_014083700.1.79200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]