SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|CocheC5_1|85908|estExt_Genewise1.C_70760 from Cochliobolus heterostrophus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|CocheC5_1|85908|estExt_Genewise1.C_70760
Domain Number 1 Region: 227-320
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 3.14e-32
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.00017
Further Details:      
 
Domain Number 2 Region: 307-420
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.3e-23
Family UBX domain 0.00084
Further Details:      
 
Domain Number 3 Region: 6-47
Classification Level Classification E-value
Superfamily UBA-like 0.0000143
Family UBA domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|CocheC5_1|85908|estExt_Genewise1.C_70760
Sequence length 434
Sequence
MSEAATDRDAQVAQLASLTGLDAATAERYLNASNGDLTLAASLFFDQTAEQQEADSEPDV
DMAGDDDSTNNPSQNPPPPSGGGRTLGGDYVPSSAPAAASSSSSQRPAGRGQPTQRGVAG
ARTLRDLQSSGGGHGHAHDDDDDEHSPEDDSQDFFAGGEKSGLAVQNPSQSNPRDQINNI
LKRARQNAPRPGGDDEQPASSHFRGAGTTLGGDDAPSRIIPDPNANMPAPPPRAHRELHL
WRDGFSVDDGDLFRYDDPANARTLEMINTGHAPLHILNVEHGQEVDVEVHAHKDEDYKKP
KKKYVPFSGSGNRLGSPTPGSSSTAATMAAAGPSSTGASTSGGSAQPSVEVDSSIPTLTL
QVRLGDGTRLTSRFNTTHTIGDVYDFVTRASAASQGREWALMTTFPSKELTDKGQVLGDI
AEFKRGGVVVQKWK
Download sequence
Identical sequences M2UWU2 N4X4L2
XP_014081873.1.79200 jgi|CocheC5_1|85908|estExt_Genewise1.C_70760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]